SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91773288|ref|YP_565980.1| from Methanococcoides burtonii DSM 6242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91773288|ref|YP_565980.1|
Domain Number 1 Region: 164-356
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.24e-62
Family Actin/HSP70 0.000000722
Further Details:      
 
Domain Number 2 Region: 358-514
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 4.97e-58
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.00000303
Further Details:      
 
Domain Number 3 Region: 1-160
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.17e-56
Family Actin/HSP70 0.00000494
Further Details:      
 
Domain Number 4 Region: 481-589
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 5.36e-18
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|91773288|ref|YP_565980.1|
Sequence length 620
Comment molecular chaperone DnaK [Methanococcoides burtonii DSM 6242]
Sequence
MGKILGIDLGTTNSCMAVIEGGKPTVIPNAEGGRTTPSVVGFSKKGDKLVGQVAKRQMIA
NPGNSVSSIKRHIGEGDYKVNLSGKDYTPQEVSAMILRKLKDDAEAYLGETITQTVITVP
AYFNDSQRQATKDAGQIAGLEVLRIINEPTAASLAYGLDKEEGDHKILVYDLGGGTFDVS
ILELGDGVFEVLSTSGNTHLGGDDFDQRITEFLVEEFKKAEGIDLSNDKAALQRLNDAAE
KAKIELSGVASTNVNLPFITADSNGQPKHIDIDITRAQFEKMTEDLVAKTLESMKMALSD
AKLTTKDIDRVLLIGGSTRTPAVYNLVKNFIGKDPYKNINPDEAVAVGAAIQAGVLSGEV
HDVLLLDVTPLTMGIETLGGVATPLIERNTTIPVKKSQIFSTAADSQPSVEIHILQGERG
IASANKTLGRFVLDGIPPAPRGLPQIEVTFDIDSNGILHVNAKDLGTGKEQSISIQKPGG
LSDEEIERMVKDAELHAEEDKARKEEVETRNNADSLVNAAENTLKEAGDVATNEQKEQIE
AAIADLKTALEGEDLEAIKSKTEALQESVYKVSAAMYEKAQKEASAGAEASEDASGPSST
GSASDDDVVDADYEVVDEDK
Download sequence
Identical sequences Q12WE6
259564.Mbur_1312 WP_011499375.1.71292 gi|91773288|ref|YP_565980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]