SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91773658|ref|YP_566350.1| from Methanococcoides burtonii DSM 6242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91773658|ref|YP_566350.1|
Domain Number 1 Region: 905-1193
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.98e-77
Family Complement components 0.0000422
Further Details:      
 
Domain Number 2 Region: 1271-1394
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.05e-20
Family Alpha-macroglobulin receptor domain 0.0013
Further Details:      
 
Domain Number 3 Region: 754-831
Classification Level Classification E-value
Superfamily E set domains 0.00000882
Family Arrestin/Vps26-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|91773658|ref|YP_566350.1|
Sequence length 1403
Comment A-macroglobulin like protein [Methanococcoides burtonii DSM 6242]
Sequence
MKYNGVTKKGFCLLVLLSCILLAGCIGQDDGNVQTSSNEALSYDEGGTYSEEDEYLVLVP
KALFSGGESSVTMSAFLDDEPVSRGVEYTLTSAAGDIIPLVKAATSESGNNVAKFDVPDV
EEGSYTLTATPSGAESGFTTTVKVMQNNPIFIETDKPIYKPGQIIHVRLLSLNNNLIPVV
QNTTVEIADAKGVKIYKDDLVTNEYGVAFFDLPLASELNLGTWKVKATSGSSMSEVDIRV
EKYVLPKFDLETSTEKSWFLADEPITGTVSANYFFGKVVEGTVEVKASRYVGVWEEYSTS
TATLKDGNVEFTLPAVGYVAGTFGAGGQGSVMLNVTVTDTGGNSEESTELLTIAEHPFIM
QMIPESNSIKPGMPLQVLLVTKDPGGEPLEKEVTLVANFRDDNYNYEEIKETYTTETGIA
LVTLEIPEDAVSVELSAASEKVKASSTLNSVYSPSASFLHLSQVSEGIPEVGDVISFKVY
STNAGTVFYDVFANGRTVYSATSDEPQINILVTPQMSPSAKVVAYLINPNNEVSADSLPF
DVKFSTQVDLSTGFDEEMVAPGDAVSVELDAGTKSMIGLSIVDESVYALSEGRLNLKQVF
DELEIRFMEPRVEAHPQYFGYQTTAYDVLDDAGMIVLASGSLEIPRSQTNDAKFIDFAAA
VFEMDGMEVMDEAVMEMPREEAAMDDEADSGEQLAEVERVRQFFPETWIWMPEILTDDNG
LATLDLNAPDSITKWRLHAVSSGPEGIGISEAGLTVFQDFFIDPDLPYAVIRGEEFPVQV
QVYNYLDMPQNVKLTLSGAEWFELVGDDVVEVGVDANSVTHVSFTIRPTRVGVQTVELTG
QTTEKADAIRKTIIVEAEGVTREIVDNGILKNGTVELDATLPDAIVPDSEKVILSFTPSI
VAQTISGVDDLLGMPYGCGEQNMMLFSTDVEVLRYLKATGQQNPEVQAKALTFITTGYQR
ELTFMHSDGSFSAFGESDGEGSLWLTSFVLSQFSGARDLTTIDENIVREAAEWIGSYQKE
DGSWEAVGFVIHEDMMGGVSGTYALTAYVTLALDEYGYAAPIVMENARSYLEAELDKQDD
PYALAIGTLALQKLESDRADESMEKLLELAKEDENGVYWGYDDVMPEPYEYGGYGFHPIS
SKNVETTAYATLALIETNDPRASSSLKWIAAQRNSNGGFSSTQDTVMAFRALMTAAAVAG
RDVDATVTVSGDGVEIKGLRITSENYDVVNIIEVPEGVEVLEMELSGSGELNYQLVRRFN
VILPEIIEHEQIELDVEYDSTDVEVDDVVKVDVRLKYNGMPGIRGVIESSGMMIVDIAVP
TGFTPVGSSLEALKEDGTITRYEIAGRKIILYIDEMMPGEEMEFSLNMRAMFPVKAMVQE
SSAYSYYNPEVKAEVKGMNVTVV
Download sequence
Identical sequences Q12VC6
259564.Mbur_1707 gi|91773658|ref|YP_566350.1| WP_011499743.1.71292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]