SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91773808|ref|YP_566500.1| from Methanococcoides burtonii DSM 6242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91773808|ref|YP_566500.1|
Domain Number 1 Region: 15-246
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.18e-26
Family Alanine racemase-like, N-terminal domain 0.0057
Further Details:      
 
Domain Number 2 Region: 216-335
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.77e-16
Family Eukaryotic ODC-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|91773808|ref|YP_566500.1|
Sequence length 349
Comment Orn/DAP/Arg decarboxylase 2 [Methanococcoides burtonii DSM 6242]
Sequence
MNSNIPAPRFTLSKKIILEQYHKVKDVADIVAFSSKTNPKVSPLIEAETDGLLSVHMPNE
LKHTEDMSRVLFLAQAWTPEMIRELYEKGIRSFAVDNEFDLDTLLSTVDDTDWKITLLLR
LKLKEHSIRTERYFVFGMSSDTINKRIAQLKGNKNIEKLGVHFHRKTQNVNEWKIQPEIE
DALTEGTLEAIDILNIGGGLPSEYANTNVDVINGIFRRISELREWLHEKEIKLMIEPGRF
ISAPAGKLVSHITGVYDNNIIVNASVYNSDMDAILVPVKLRIEGEVGNDSGEPYVVKGCT
PCSMDLFRYRVYLKDEPKIGDELVFINAGAYNFWSNFCDLEEIVTEIVE
Download sequence
Identical sequences Q12UX6
259564.Mbur_1867 gi|91773808|ref|YP_566500.1| WP_011499893.1.71292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]