SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91773867|ref|YP_566559.1| from Methanococcoides burtonii DSM 6242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91773867|ref|YP_566559.1|
Domain Number 1 Region: 206-538
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 3.41e-103
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.0000168
Further Details:      
 
Domain Number 2 Region: 2-192
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.31e-67
Family Inosicase 0.00000608
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|91773867|ref|YP_566559.1|
Sequence length 538
Comment phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [Methanococcoides burtonii DSM 6242]
Sequence
MVKRALLSVSDKTGIVDFARGLEQLNIEIISTGGTAKMLRDAGIETIDVSEVTGFPEMMG
GRVKTLHPKIHGGLLCMRGDPEHMGEAEKESIKLIDLVAVNLYPFEITVSKEGVNLDEAI
ENIDIGGPTLLRSAAKNYKSVTVVSDPEDYGEILKELRSSGTVSDTTREKLAVKVFRYTA
NYDSNIDTYLSKTLLDEDVLRMNFTEGTKLRYGENWHQDATFYKDETIVGPALSNAKQLH
GKELSYNNYVDADNALQTIKEVGNRNPAVAIVKHNNPCGLATGNTLCEALEHAWDGDPVS
AFGSIICTNTVFDLESAEFLKGKFVEIILAPGFEHDALEYLEDKSSNLRLLELPQFNEAF
DTETTYKYVIGGMLKQTRNIGLYEKWDCVTETAYPEEKRGLSEFCICACKSTKSNSVTLA
YEYKDGCYVMIAMGAGQPNRVDSIRKLAATKAKENLEIIYEREKPDMSFEEYWQSILSEA
VMASDAFFPFDDSIIYSDESKIRYILSPGGSIRDDEVIATANRLNISMVFTGMRHFLH
Download sequence
Identical sequences Q12UR7
gi|91773867|ref|YP_566559.1| WP_011499951.1.71292 259564.Mbur_1928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]