SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91774023|ref|YP_566715.1| from Methanococcoides burtonii DSM 6242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91774023|ref|YP_566715.1|
Domain Number 1 Region: 25-171
Classification Level Classification E-value
Superfamily YutG-like 6.28e-35
Family YutG-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|91774023|ref|YP_566715.1|
Sequence length 195
Comment hypothetical protein Mbur_2091 [Methanococcoides burtonii DSM 6242]
Sequence
MKLSDINSQDLKKDQPKELEGDIDHNIIEILEEEGITVDMLVDTALELYAPHPGLETREI
AEERFRRELYIAISDANLCLLIYSGILLEREGEKGKLPNISRSSYEMDLTFIIADEVIGM
SIAKYISGDKGIFEFVRFDKQKPGILSKLGPFMDDVIGGLIGGVSANMYTRGMAEAAENE
RKPKKNLNNSGAIAG
Download sequence
Identical sequences Q12UB1
WP_011500105.1.71292 gi|91774023|ref|YP_566715.1| 2005373409 259564.Mbur_2091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]