SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|552658105|ref|YP_008688545.1| from Mesoplasma florum W37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|552658105|ref|YP_008688545.1|
Domain Number 1 Region: 13-356
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.38e-98
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|552658105|ref|YP_008688545.1|
Sequence length 370
Comment Pyruvate dehydrogenase E1 component alpha subunit [Mesoplasma florum W37]
Sequence
MKYIGKFDPQKDEIVRVMDKDGKIINPKLAPSISDEELIKAYSIMNLSRRQDDYQNKMQR
QGRLLSFLSSTGQEACEVAYTMVIDPKNDFFVSGYRNNAAWLTMGQTVRNIMLYWAGNEA
GAKAPEGVNSLPPNIIIGSQYSQATGIAFAEKYQGKKGVAVTTTGDGGMSEGETYEAMNF
AKLHELPVVFVCENNKWAISTPTVQQTKSLNIAVKAIATGTPSIKVDGNDFLASYAVAKE
AVEFARSGNGPVLIEFDTYRLGAHSSSDAPDVYRPKGEFEDRVPYEPLIRLKAYMIEKGI
WSEEKQTALNEEQDKHIAAEFAWVEQNKNYPIEDIFNYQYAELTNDLKDQLAEAKEFFAK
YPETKDGGHH
Download sequence
Identical sequences A0A291MPY9 Q6F278 U5PBM6
gi|552658105|ref|YP_008688545.1| gi|50364854|ref|YP_053279.1| 265311.Mfl039 WP_011182936.1.37507 YP_053279.1.45369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]