SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390945389|ref|YP_006409149.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390945389|ref|YP_006409149.1|
Domain Number 1 Region: 234-495
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.87e-61
Family Pyruvate oxidase and decarboxylase Pyr module 0.039
Further Details:      
 
Domain Number 2 Region: 14-230
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.76e-21
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.022
Further Details:      
 
Domain Number 3 Region: 508-612
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000157
Family Transketolase C-terminal domain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390945389|ref|YP_006409149.1|
Sequence length 614
Comment 2-oxoacid:acceptor oxidoreductase subunit alpha [Alistipes finegoldii DSM 17242]
Sequence
MEKTNVRELQDVVIRFSGDSGDGMQLTGTLFSDTSALLGNGISTFPDYPAEIRAPQGTVA
GVSGFQVHFGSHRELNPGDYCDVLVAMNPAALKANRKWLKQGATVIIDGDSITEEHLKKA
GFATLDPIAELGLDEYNVVIPDITSMTREALKQTGLDNKAVVKCKNMFALGICFYLFDRP
EAYAYKYLETKFARKNPVVAEANKLAIDAGYNYAANTHQFANTYTVSPAPLEKGTYRTIN
GNVATAWGLCAAAEKAGLPLFCGSYPITPATVILEELAKRKDLGVKTVQAEDEIAGICTA
IGAAFAGNFAVTTTSGPGLSLKSEALGLAVMTELPLVVVDVQRGGPSTGLPTKTEQSDLS
QALYGRNGECPVIVVAASSPSDCFHYAFEAGRLAMEHMTPVILLTDGFIANGSEPWRIPS
MKDYPAIQPPIVDDAPEGGFMPYVRDEKLARGWAFPGKVGLEHRVGGLEKDCVKGCISHD
PSNHQKMVSTRAAKVAKAADDIPAQTVWGDPEGDLLVVGWGGTRGHLQNAVDQMRAEGKR
VSLAHFNYINPLPHGVRDIFAKFRRIVVCELNEGQFANYLRQNLQEFRYEQYNKCEGLPF
TVVELKEKFESLLK
Download sequence
Identical sequences I3YHJ6 R5V0T3
gi|390945389|ref|YP_006409149.1| WP_014774311.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]