SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390945413|ref|YP_006409173.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390945413|ref|YP_006409173.1|
Domain Number 1 Region: 486-593
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000178
Family Galactose-binding domain 0.026
Further Details:      
 
Domain Number 2 Region: 775-887
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000495
Family Galactose-binding domain 0.055
Further Details:      
 
Domain Number 3 Region: 200-312
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000116
Family Galactose-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390945413|ref|YP_006409173.1|
Sequence length 889
Comment hypothetical protein Alfi_0072 [Alistipes finegoldii DSM 17242]
Sequence
MKNITKYILAAAAAFSSLTACQEFEDFDKTIDGTPGLVYVQTGTENLYTIRVVHKPTGST
GEFFTEFPVRCNTTRHAGVKATFVYDASLVESYNAEHKTSYAALPAEYLTLENTTLTVPE
NATASADSVKVTLTGNLSLLTERNYLAPLRIKAEGIDASEVMGAVYVAVATEINLIRAIE
STDDMVGFTATGRSAWTADCGNYANLFDGSTSTSVDFPEQYGNVLNIDMKEPQLVTGLCL
GYGSVPSVSIEYSADGETFSQAGTPVSGEYVTSGSRMYAAFYGHIEARYLRLTIGFSSSW
SKTLSEIDIYKIDSEDPTVYAVTGTENLITGKITHRQTGSTSDVNASFSAYATVASTSGY
TVSVAADNSLVAAYNTAHDTSYAALSAEYLQLDNSTLTIAAGAYKSEGEVTVSLKGDLTR
LGDLNGYLAPLKLSSSGAGTSAGRGVVYLAVKVEQNKIRPITSVDDMVGFPAAGRTAWTA
DCPDYANLFDGSASTRTNFTDQNDNVVTIDMKSTHMVTGIDLNSAGISSVSFEYSTDGQT
FLTAGTPASNEYATSGSDRYIAFYDYLEARYLRLTISFSSSWSKYISEFNIYEIESDEPT
VYAMCGSDNVLTGAIAHTPGGSFNGLNAAFNVYCTVSSASGYSVSATADNSLIAAYNSAN
GTSYAALPDGHLLLENNPCAIGPNNNKSDGQIKASLTGDLTGLTNAKGYLVPLKLSAQDA
VTSSSRGVVYLVITPAEELFRKNFTVADITGALVADRSGWSITGGDYHSGSWPEVIDDST
DTFMRPWGSPIMFTITFDKEYEMTGLRITARTDNASYQNYQPNAITIEYSLNGEDYTELG
TAASADGSLLKNVPSSYVALYGSQKMKYIRITASYGSNMGVGDFNIYAK
Download sequence
Identical sequences I3YHM0
gi|390945413|ref|YP_006409173.1| WP_014774327.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]