SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390945443|ref|YP_006409203.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390945443|ref|YP_006409203.1|
Domain Number 1 Region: 22-93
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000000524
Family HMA, heavy metal-associated domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390945443|ref|YP_006409203.1|
Sequence length 98
Comment copper chaperone [Alistipes finegoldii DSM 17242]
Sequence
MLCLALVMGVGMCAAEKPANKKTVTTVFTTDIDCEHCVKKIMNNVPSLGKGVKDVQVDLP
KKEVTVVYDGTKNNDENIVKGFASLKVKAEPKKADAKK
Download sequence
Identical sequences I3YHQ0 R5V136
gi|390945443|ref|YP_006409203.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]