SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390945463|ref|YP_006409223.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390945463|ref|YP_006409223.1|
Domain Number 1 Region: 3-73,158-341
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.5e-85
Family Pyruvate kinase 0.00000701
Further Details:      
 
Domain Number 2 Region: 324-475
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 5.23e-21
Family Pyruvate kinase, C-terminal domain 0.011
Further Details:      
 
Domain Number 3 Region: 69-169
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 9.77e-18
Family Pyruvate kinase beta-barrel domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390945463|ref|YP_006409223.1|
Sequence length 491
Comment pyruvate kinase [Alistipes finegoldii DSM 17242]
Sequence
MYRMKKTKIVATMSDFRCTEEFVKNLYDAGMDVVRVNSAHVTEDGATHIVETVHRVNPAI
PIMIDTKGPEIRVTTIADEYGNSINFRVGDRVAVRGSDGSDMTTRKVVYMNVPTIVRDIP
VGARMLIADGELEIRVVEKTDEELICEFVVGGAMRSRKSVNVPAVSIDLPSVTEKDRRFI
EWAVKNDVDFIAHSFVRSAKDIKAVQEILDAHGSKIKIISKIENQEGLDNIDEIIEASYG
IMVARGDLGVELPAEAIPNTQRRIVEKCICAKRPVIIATQMLYSMVKSPRPTRAEVSDVA
SAIYERVDAVMLSDETAMGDYPVESVETMARVAREIERDETHFKPMIDMDMVSVNHEITA
QLARSAVRASTNLPIKYVVLDTKTGRTGRYLAAFRGRKTVMAVCYQLHAQRILALSYGVV
PILRNQELHDKYHFLVDALEFLDQYRKLKGEDLLAIVGGSFGPDGGASYVEIANVDNIRR
RNEEIVAAQKC
Download sequence
Identical sequences A0A1Q6EYK1 E4MEY1 I3YHS0 R5UNS5
gi|390945463|ref|YP_006409223.1| WP_009598842.1.56960 WP_009598842.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]