SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390945496|ref|YP_006409256.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390945496|ref|YP_006409256.1|
Domain Number 1 Region: 795-1177
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.5e-129
Family PFOR PP module 0.0000000042
Further Details:      
 
Domain Number 2 Region: 418-670
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.35e-79
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000264
Further Details:      
 
Domain Number 3 Region: 4-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5e-78
Family PFOR Pyr module 0.0000000113
Further Details:      
 
Domain Number 4 Region: 261-414
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.67e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000297
Further Details:      
 
Domain Number 5 Region: 674-834
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.79e-20
Family Ferredoxin domains from multidomain proteins 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390945496|ref|YP_006409256.1|
Sequence length 1177
Comment pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Alistipes finegoldii DSM 17242]
Sequence
MAEKKFITCDGNYAAAHVAYMFSEVAAIYPITPSSTMAELVDEWAAQGRKNIFGETVKVV
EMQSEAGAAGAVHGSLQSGALTSTFTASQGLLLMIPNMYKISGELLPGVFHVSARALAAQ
SLSIFGDHQDVMATRQTGFAMIATSSVQEVMDLAGVAHIVALKSRVPFLHFFDGFRTSHE
IQKIELIDEAALTAMLDRDALKAFRQRALNPEHPVTRGTAQNPDIYFQTREAANTFYDAV
PDMVADAMREISKITGREYKPFVYYGAADAENIVIAMGSVTETLKETVDYLNAKGGKVGV
VTVHLYRPFSVKYMMEVLPESVKRICVLDRTKEPGANGDPLYLDVVEAFATCPCKNKPLI
IGGRYGLSSKDTTPAQMLAVFTNLAANEPKNQFTVGIVDDVTFRSLPVGEEISLAKPGTF
EALFFGLGADGTVGANKNSIKIIGGTTNKYCQAYFSYDSKKSGGYTSSHLRFGDLPITSP
YLVTTPDFVACHVPSYVDKYDVLKGLKAGGSFLLNSVHDAATTCETLPAHMKAYLAKNKI
NFYIINATKIAAELGLGSRTNTIMQSAFFKIANVIPFDKAVEQMKKAIQKSYGKKGEDIV
NMNYAAVDAGGDAVVKVEIPAEWASIEDKGFVHVSDASCPEFVRKIVEPINGLKGDDLPV
SAFTGREDGTWENGTAAYEKRGIAVNVPEWKIENCIQCNQCAYVCPHAVIRPFLATEAEA
AASGVEWKQGLGETKDYKFRIQISPLDCTGCSNCVDVCPAKEKALVMKPLESQLPQQRNW
DYIVKNIGYKQVVDKTKSVKNLQFAQPLFEFSGACAGCGETPYIKAISQLFGEKMMVANA
TGCTSIYSGSAPSTPYCTNDKGQGPAWANSLFEDNAEFGLGMHVGVEKLRDRIQESMEQA
IAGCTKCSDELKGVMQEWIAARGSSAKSAEVSARLIPMMEACGCDYCKGILEMKDWLVKK
SQWIIGGDGWGYDIGFGGVDHVLASGLDVNILVVDTEVYSNTGGQSSKSTPVGAVAKFAS
AGKRIRKKDLGAIAMTYGYVYVAQVSIGASQMQLFNVLKEAEAYPGPSLVIAYAPCINHG
IKGGMTRTQTVGKEAVACGYWHLWHYNPQLEEQGKNPFVMDSKEPDWSKFRDFLMKEVRY
TSLKKSFPAEAEELFAAAEENAKWRYNSYQRLAKMEY
Download sequence
Identical sequences I3YHV3
gi|390945496|ref|YP_006409256.1| WP_014774383.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]