SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390945597|ref|YP_006409357.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390945597|ref|YP_006409357.1|
Domain Number 1 Region: 9-45,73-183
Classification Level Classification E-value
Superfamily Flavoproteins 8.12e-18
Family Flavodoxin-related 0.043
Further Details:      
 
Domain Number 2 Region: 215-283
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.12e-16
Family Short-chain ferredoxins 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390945597|ref|YP_006409357.1|
Sequence length 302
Comment hypothetical protein Alfi_0265 [Alistipes finegoldii DSM 17242]
Sequence
MNPTAVYTVVFSPTGTSRKIAAAVAQGVARHGGSCNATANTAAGADAGTNAATGSAAKAF
TTIDLTHAAGKPPVLPADAAAVFAVPVYGGRVAPAALERLQEIRGEGTPAVVLAVYGNRA
FGTAVAQLAAFVAERGFVPVAAGAFVGEHSYSTPGTPIAEGRPDTQDLAEAAAFGARIGQ
KLAHGETGPIDAAKLREPHTPLLSKLRFIRFVLGYRRRQKRNPVALLPAGDAARCTQCGR
CVALCPTQAIARGDELHTDPARCIRCCACVKGCAFGARTFETPFAAVLSRNFARRKPPVT
LM
Download sequence
Identical sequences I3YI54
WP_014774468.1.56960 gi|390945597|ref|YP_006409357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]