SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390945633|ref|YP_006409393.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|390945633|ref|YP_006409393.1|
Domain Number - Region: 491-539
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0115
Family Fibronectin type III 0.009
Further Details:      
 
Domain Number - Region: 58-131
Classification Level Classification E-value
Superfamily CalX-like 0.0128
Family CalX-beta domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390945633|ref|YP_006409393.1|
Sequence length 817
Comment hypothetical protein Alfi_0305 [Alistipes finegoldii DSM 17242]
Sequence
MKAIKYFLYALIATFVFAGCSDDPTYTRGESEADGCYGVYFPSQDNAADLELDPADPTVL
TFTAMRTNDADAITVPVTVTGSEDAIFSASEISFDDGATETTFQVSFPDAEIGTTYSCNI
QIEDKKYAFIYGEKASGVSFSVTRVKWNLVTGPKGETKGKWRDDILSSAYGIPNRYGEGE
VEIYERDDNPGYYRISNVYSAEYLASLLNMSPSEVSGNRSDVITYIDATNPDKVWLPEQS
TGVFLNSGDGIVSFASQVPENGFNGSGYGTNVNGVITFPAKSVLLMFGDDGWYVGNAGGM
QRLMLPGAEEYDFSLALTDSEPADGKVEIAAKLGADVAKVKYAFFEGVFGDAIAKANSAG
IDAGTVESKEITADGTIVAQFEETGKYTVVANIYDEAGELQGYEFLSFGYVKAGDDKPVV
LSVRTELTWEFEAQGHTPENSIRSILFGENIESGYMGLFKSADLTGKSSEDLIEIAKTSG
KAITAEEIDKINDTGLSLLHKGLNAGTDYVLLVWAYNGYYGKLYSVQQTTAGKPDPLQIH
YTYDDVENGLTKAGYCGTWDYYAVDAYDKTGNTSRQYFGQVVVEDGGTTSGYADFDNVFS
DYVKVSGLTGAPQAFNAGESQYMAWSGGLLYVLAPQLIGNVTLQGTDYFVNVAYTAEGDD
GVYSGRGLLLGAPVADGLVAFVPNPQLQASNNLTFTGMWFGIYAGYDPATNKFSGGEGGI
VFHEWLLLADPDLYPAADMASVVKALSVQPGNYVELRGPELAKVIVGENRMPADRGRECE
IVGMPALGAAKAKVEFRQGIAARSADFTRRTGAKITE
Download sequence
Identical sequences I3YI90
WP_014774504.1.56960 gi|390945633|ref|YP_006409393.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]