SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390945674|ref|YP_006409434.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390945674|ref|YP_006409434.1|
Domain Number 1 Region: 325-607
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.47e-90
Family beta-glycanases 0.0000000802
Further Details:      
 
Domain Number 2 Region: 745-1014
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.53e-64
Family beta-Galactosidase, domain 5 0.00023
Further Details:      
 
Domain Number 3 Region: 24-221
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.31e-56
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0000209
Further Details:      
 
Domain Number 4 Region: 603-711
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 1.22e-20
Family beta-Galactosidase/glucuronidase domain 0.0033
Further Details:      
 
Domain Number 5 Region: 224-323
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 8.92e-20
Family beta-Galactosidase/glucuronidase domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390945674|ref|YP_006409434.1|
Sequence length 1017
Comment beta-galactosidase/beta-glucuronidase [Alistipes finegoldii DSM 17242]
Sequence
MKKTLLILAAALSGALAASAQTGREWQDPAVNEINRLPMHSTFAAGESMPLDGVWKFHWV
RNASERPSGIWQVDYDDASWGAMPVPGMWELNGYGDPLYVNVGYAWRGNFENNPPHVPDA
ENHVGSYRHTFEVPASWSGKDIFLSIGSATSNVYVWINGRFVGYSEDSKLAAEFDVTKFV
KPGENLIALQMFRWSDGTYLEDQDFWRFSGIARGVTLTARDKAHLKDVRITPTLDADYRD
AQLHVEVETTPRVKSVGLTLLDAAGEAVAEQQIMPAGGKAGCLFRVADPAKWSAEAPNLY
TLRIDVSDGRNVTETVTQPVGFRSVEIRNAQLLVNGQPVLIKGADRHEMDPIGGYVVSRE
RMIEDIRIMKEMNINAVRTSHYPNDPQWYELCDEYGIYVVDEANVESHGMGYGEETLAKV
PAFAQAHMERNQRMVLRDKNHPSVIVWSMGNEAGMGPNFEACYRWIKDYDASRPVHYERA
VYDRDGAFTDIICPMYWDYAQCEKYLKNNPSKPLIQCEYAHAMGNSMGGLDHYWKLVRQY
PSYQGGFIWDFVDQGLARYEKNGRVSFLYGGDFNNYDATDNSFNCNGIIAPDRTWHPHAY
EVKRQYQNIWTELLDPAQGRVEVYNENFFVGLDDYELTWELVADGRVVKAGRIGELDVAP
RQRRTYALGFTSADFCPQAKELLVNVAYKLKNKRPLLDIGHTAAQQQFVVREYDCKAGFG
LAASERPVEVTAWERGTRVAGQTWEMFFSRDGFLCAYDVDGRALMAEGAELRPQFWRAPT
ENDLGAKLDRKLAVWKNPELKLTKFDAGVKDGVAVVEALYELPAVKATLALTYRINGAGE
MEVTERMTAGKSAKVPNLLRYGMTLTMPARYGRVIYYGRGEHENYADRLSSADLGLYEQR
VADQYHDEYVRPQESGTKSDVRWWTVADSSGTGLTILSDAPFSASALPYATADLDVSNFP
PQQHSGTLTARDATFVNFDLRQSGLGCIDSWGQLPEERFRVPYGDYTFRFLLRPTIK
Download sequence
Identical sequences I3YID1
gi|390945674|ref|YP_006409434.1| WP_014774537.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]