SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390945689|ref|YP_006409449.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390945689|ref|YP_006409449.1|
Domain Number 1 Region: 21-340
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.43e-92
Family Putative alpha-L-fucosidase, catalytic domain 0.0013
Further Details:      
 
Domain Number 2 Region: 343-476
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000000234
Family Galactose-binding domain 0.08
Further Details:      
 
Domain Number 3 Region: 572-677
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000408
Family Galactose-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390945689|ref|YP_006409449.1|
Sequence length 680
Comment alpha-L-fucosidase [Alistipes finegoldii DSM 17242]
Sequence
MKRTLSVFLLFAAACGRVEAPAPLFPVPNARQLAWQQLETYAFVHYGLNTFNDMEWGYGD
TPASTFDPADLDCDQWVRTFRAAGMKGVMLTAKHHDGFCLWPSAYTEYSVKNSPWRGGKG
DLVRELSDACRRHGLKFGIYLSPWDRNHPEYGREEYVAYFHNQMRELLTGYGPLFEYWFD
GANGGDGWYGGADEKRSIDAKTYYGYERARRTINELQPGAVIFGGTCADIRWIGNEEGRA
GQTNWSMVKGRGDERLNDFTCGESDGDTWLPGECDVSIRPGWFYHPREDHQLKSLSRLID
IYYESVGRNANLLLNFPVDRSGRIAPADSARIMEWRRALDAEFAHDLFGEAQATADNVRG
GARRFSAAKAVDGRADTYWATDDGVTAATLSLQFERPRRVNRILLQEYIPLGQRVGRFAV
EWLDGDTWRPVETAEEMTTIGYKRIIRFAGVTTPALRVRFGQARGPLCISNVGAYDAPVL
LEEPRIVRNGAGEVTLAAGDTQAEIRYTLDGTEPGPSSELYAKPFPMTGRGVVKALVRDP
EDGRMSAVASRGFDIPCGAFRVKELPDEEAVGLFDGDVSTVVYLPAGVAGFSADTGEERT
FRGFAYTPDQSRWASGVVTRYRVSVDGRTAAEGEFSNIVNNPVEQVVEFEPLRGRTVRFE
ALSLAAGDRPGIAEFSVLTE
Download sequence
Identical sequences I3YIE6
WP_014774549.1.56960 gi|390945689|ref|YP_006409449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]