SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390945747|ref|YP_006409507.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|390945747|ref|YP_006409507.1|
Domain Number - Region: 46-99
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0859
Family Fibronectin type III 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390945747|ref|YP_006409507.1|
Sequence length 374
Comment hypothetical protein Alfi_0426 [Alistipes finegoldii DSM 17242]
Sequence
MKKILNILMAALVLTGISCSEDLEYKPGGVTPVQTLLLPADNYYVELQSASTATLRFSWE
PALAADGQLPHYEVVFFGKPGGEIVYRCDAGSSTSVDIVHKEINRIANAAGIDVGADGAV
YWSVVSSRGVDTAPVVATPRRLELTRLLGFNVIPDQLFLTGEATEGGSDLENACVGRKTG
DGEFTFYQQLEAGKGFTFVSSKGDDRTTYTVVNGALNDQSAEPATIDRSGVYRIKLDLNV
RGITFEHIDRVEFNFAPRTEDNGNMEYIGNGCWKFSDYNVKFREESWGLDQRYNFHPVFD
GVTYVWAGTKGNDSSPSALSGAEYYILTENLFTGDAYGPEKFKFHSDFNGKKVDITLIMS
GDVENCTHVIEIVG
Download sequence
Identical sequences I3YIK4
gi|390945747|ref|YP_006409507.1| WP_014774596.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]