SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390945861|ref|YP_006409621.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390945861|ref|YP_006409621.1|
Domain Number 1 Region: 94-361
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.94e-47
Family Lambda integrase-like, catalytic core 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390945861|ref|YP_006409621.1|
Sequence length 371
Comment site-specific recombinase XerD [Alistipes finegoldii DSM 17242]
Sequence
MHECKTVTLRTRPLKGRMMSFYLDYYPGYRDKETMKVIRHESLGIYIYANPRNKREQNFN
EVMTEKAEAIRCRRFESVVNERYDFFDKYKLKADFLEYYRKQLRKHDQKWEFVYLHFSNF
VHGKCTFEEIDIDLCNKFREYLLSAKKLRRNGRITRNSASGYWSTFRGFLKILYRNGMIK
TNVNDFLEKIETEDVMKEALSVEELYKLAETPCKKPILKTASLFSCMTSLRISDILSLCW
EDIVDYSAGGKCVHIITQKNKAEDIIPISEEALGLIGYNSEKKGLVFKGLMRSWTQIPMK
EWIRSAGITKNITFHSYRRTFATLQAAAGTDIRTIQSIMAHKSITTTQRYIKVVDANKRE
ASKKITLTRQD
Download sequence
Identical sequences A0A1C6L005 A0A1Y4PUX9 I3YIW8
gi|390945861|ref|YP_006409621.1| WP_014774667.1.10487 WP_014774667.1.39779 WP_014774667.1.56960 WP_014774667.1.76205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]