SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390945870|ref|YP_006409630.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390945870|ref|YP_006409630.1|
Domain Number 1 Region: 2-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.01e-69
Family G proteins 0.0000233
Further Details:      
 
Domain Number 2 Region: 420-533
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.69e-20
Family Translational machinery components 0.0033
Further Details:      
 
Domain Number 3 Region: 226-333
Classification Level Classification E-value
Superfamily Translation proteins 2.58e-17
Family Elongation factors 0.01
Further Details:      
 
Domain Number 4 Region: 536-622
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000000182
Family EF-G/eEF-2 domains III and V 0.01
Further Details:      
 
Domain Number 5 Region: 344-417
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000000504
Family EF-G/eEF-2 domains III and V 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390945870|ref|YP_006409630.1|
Sequence length 641
Comment small GTP-binding protein domain-containing protein [Alistipes finegoldii DSM 17242]
Sequence
MNIINLGILAHIDAGKTSVTENLLFASGATEKCGRVDNGDTITDSMDIEKRRGITVRAST
TSIIWNGVKCNIIDTPGHMDFIAEVERTFKMLDGAVLILSAKEGIQAQTKLLFSTLQKLQ
IPTIIFINKIDRAGVNLERLYMDIKTNLSQDVLFMQTVVDGSVYPVCSQTYIKEEYKEFV
CNHDDDILERYLADSEISPADYWNTIIALVAKAKVYPVLHGSAMFNIGINELLDAISSFI
LPPASVSNRLSAYLYKIEHDPKGHKRSFLKIIDGSLRLRDVVRINDSEKFIKIKNLKTIY
QGREINVDEVGANDIAIVEDIEDFRIGDYLGAKPCLIQGLSHQHPALKSSVRPNKPEERS
KVISALNTLWIEDPSLSFSINSYSDELEISLYGLTQKEIIQTLLEERFSVKVHFDEIKTI
YKERPIKKVNKIIQIEVPPNPYWATIGLTLEPLPLGAGLQIESDISYGYLNHSFQNAVFE
GIRMSCQSGLHGWEVTDLKVTFTQAEYYSPVSTPADFRQLTPYVFRLALQQSGVDILEPM
LCFELQIPQVASSKAITDLQKLMSEIEDISCNNEWCHIKGKVPLNTSKDYASEVSSYTKG
LGIFMVKPCGYQITKDGYSDNIRMNEKDKLLFMFQKSMSLK
Download sequence
Identical sequences A0A076JBW3 A0A078PLZ5 A0A078QQ29 A0A078RDG2 A0A078S0M0 A0A095Y945 A0A095Z7D6 A0A096AWK7 A0A0J6CGX6 A0A0J9FIE8 A0A0K9CPV6 A0A0P0GH02 A0A127SAM2 A0A134BEL9 A0A137SZ63 A0A139K3N9 A0A139LMW3 A0A143XYS1 A0A173S923 A0A174EPS2 A0A174VFM8 A0A174VLG4 A0A1C5VI46 A0A1C7GY30 A0A1M5DKZ1 A0A1M6FZR5 A0A1Y3QY32 A0A1Y3Z8R3 A0A1Y4CZZ2 A0A1Y4GL28 A0A1Y4JPC7 A0A1Y4Q3G0 A0A223HIK2 A0A285SBW9 A0A2D3NE57 A0A2K0XC80 A7ABM9 B0NNY0 B3C7C6 B3JIW6 B5D3E8 B6VWH0 B7AKU7 C2MCC3 C3QK95 C3R2Y7 C8C123 D1W714 D4VJ87 E4MAV9 E4W320 F3PMZ7 F7LAC1 F7M262 F9DLF0 I3YIX7 I4Z7N7 I9JE62 I9QCG7 I9T6Z2 K0X6E0 K1FGT5 K5YWG4 K5ZBW8 P70882 Q56VE4 R9H076 R9HNS8 U2J2G9 U2LBC0 W0EV24 W1R7W4
gi|390945870|ref|YP_006409630.1| 295405.BF0141 WP_004291466.1.100740 WP_004291466.1.102052 WP_004291466.1.10223 WP_004291466.1.12058 WP_004291466.1.12386 WP_004291466.1.12460 WP_004291466.1.1249 WP_004291466.1.14393 WP_004291466.1.15915 WP_004291466.1.16618 WP_004291466.1.17731 WP_004291466.1.18028 WP_004291466.1.18195 WP_004291466.1.18967 WP_004291466.1.19523 WP_004291466.1.19590 WP_004291466.1.20771 WP_004291466.1.20997 WP_004291466.1.21574 WP_004291466.1.22866 WP_004291466.1.26154 WP_004291466.1.2616 WP_004291466.1.26195 WP_004291466.1.2685 WP_004291466.1.26971 WP_004291466.1.29417 WP_004291466.1.29459 WP_004291466.1.29995 WP_004291466.1.30036 WP_004291466.1.30930 WP_004291466.1.31734 WP_004291466.1.323 WP_004291466.1.32967 WP_004291466.1.33107 WP_004291466.1.33241 WP_004291466.1.33309 WP_004291466.1.33337 WP_004291466.1.33938 WP_004291466.1.34002 WP_004291466.1.34142 WP_004291466.1.34924 WP_004291466.1.35714 WP_004291466.1.36284 WP_004291466.1.37087 WP_004291466.1.37869 WP_004291466.1.38405 WP_004291466.1.38878 WP_004291466.1.39319 WP_004291466.1.39634 WP_004291466.1.39635 WP_004291466.1.39873 WP_004291466.1.40326 WP_004291466.1.40743 WP_004291466.1.41404 WP_004291466.1.42812 WP_004291466.1.43181 WP_004291466.1.43461 WP_004291466.1.44254 WP_004291466.1.45999 WP_004291466.1.47352 WP_004291466.1.47969 WP_004291466.1.48959 WP_004291466.1.49220 WP_004291466.1.49999 WP_004291466.1.51845 WP_004291466.1.52087 WP_004291466.1.53995 WP_004291466.1.54640 WP_004291466.1.55270 WP_004291466.1.56575 WP_004291466.1.56832 WP_004291466.1.56960 WP_004291466.1.57939 WP_004291466.1.58123 WP_004291466.1.58990 WP_004291466.1.610 WP_004291466.1.61603 WP_004291466.1.61673 WP_004291466.1.61891 WP_004291466.1.61928 WP_004291466.1.6197 WP_004291466.1.64402 WP_004291466.1.65726 WP_004291466.1.665 WP_004291466.1.66724 WP_004291466.1.6673 WP_004291466.1.69811 WP_004291466.1.71497 WP_004291466.1.72222 WP_004291466.1.725 WP_004291466.1.72730 WP_004291466.1.73053 WP_004291466.1.73306 WP_004291466.1.74872 WP_004291466.1.7590 WP_004291466.1.76205 WP_004291466.1.7656 WP_004291466.1.77385 WP_004291466.1.78705 WP_004291466.1.82023 WP_004291466.1.82567 WP_004291466.1.82909 WP_004291466.1.82919 WP_004291466.1.84583 WP_004291466.1.84965 WP_004291466.1.85431 WP_004291466.1.86730 WP_004291466.1.87028 WP_004291466.1.88358 WP_004291466.1.88443 WP_004291466.1.88795 WP_004291466.1.90162 WP_004291466.1.90191 WP_004291466.1.91000 WP_004291466.1.9313 WP_004291466.1.93715 WP_004291466.1.94315 WP_004291466.1.94328 WP_004291466.1.95267 WP_004291466.1.95559 WP_004291466.1.97168 WP_004291466.1.97349 WP_004291466.1.97916 WP_004291466.1.9852 WP_004291466.1.98544 WP_004291466.1.99689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]