SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390945886|ref|YP_006409646.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390945886|ref|YP_006409646.1|
Domain Number 1 Region: 5-299
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.44e-55
Family Lambda integrase-like, catalytic core 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390945886|ref|YP_006409646.1|
Sequence length 308
Comment site-specific recombinase XerD [Alistipes finegoldii DSM 17242]
Sequence
MIQKTIREISDAWRENKRPYVKQSTLAAYMLILENHILPKFGESNELHENDVQGFVLEKL
EGGLSVKSVKDILIVLKMVMKFGVKNEWMNYYEWDIKYPTDVAGKKLEVLSVANHKKILN
YIQSHFSFPGLGIYISLSTGLRIGEICALKWSDINVYDGILTVNRTIERIYIIEGERKHT
ELVINTPKTKNSCREIPINKELLTMLKPLKKVINDDYYILTNDERPTEPRTYRNYYKRLM
EKLDIPKLKYHGLRHSFATRCIEVGCDYKTVSVLLGHSNISTTLDLYVHPNMEQKKRCIT
KVFKSLGK
Download sequence
Identical sequences A0A0E2SZ99 A0A1C6L021 A0A1Y4PS84 I3YIZ3
WP_014774681.1.10487 WP_014774681.1.39779 WP_014774681.1.50677 WP_014774681.1.56960 WP_014774681.1.76205 gi|390945886|ref|YP_006409646.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]