SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390945925|ref|YP_006409685.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390945925|ref|YP_006409685.1|
Domain Number 1 Region: 87-215
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000362
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number 2 Region: 186-312
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000162
Family Fibronectin type III 0.0053
Further Details:      
 
Weak hits

Sequence:  gi|390945925|ref|YP_006409685.1|
Domain Number - Region: 407-517
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0628
Family Tricorn protease domain 2 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390945925|ref|YP_006409685.1|
Sequence length 637
Comment hypothetical protein Alfi_0613 [Alistipes finegoldii DSM 17242]
Sequence
MIKSILSWSTALLVLCSGLLASCDDKDEGGGNPPAPAVTLAVGDAASNTLKFTLTLSDAD
KCTYVCTKSSEAVPSAEKILADGKSVTASGLITIGDLEPSTTYRLSAVASNGKVNGKVET
IEHTTSAPDVHPAVVLTPGTPTSTTLSFTAALTDPETAAYVCLEKTEGTTVPTAEEILRD
GTAIAQTGELLVENLKPATVYLIAAAVANTGVYSEVETLEMETVARTPVVTVIAGTPTET
TLSFHFKLTDAEKAAYVCIEETDNPTIPSAEEILRDGTDLPVSADAAEIRELKPGTTYIV
AVAASNKTVYSDVKTVEMTTDQAVEGPIVFDRQAAGGYYPTESSYIGEFLLVLADGETTE
SGGVYATTGAGRAMSIDLYQMAVSNPNTTITLPARDYRYATNKGLTTFDPVKTYCMVNDG
KGNITRTDFKAGTISVKKAGSTYTITATLTTTDDEEFTTSYEGPLTIENKTSTEIPDLPT
LDKDVTNLSFIRALGKYYSDSDTADQCIVNLYDVEPTISYGSDYLGQAGHLVSLDLSTAV
STEMQLQEGTYNVSASGTPGSYEAGRQTEFMDTKLPVGTYCEERNDNFQSFYGFVASGTV
TITKSGSGYRFVLDFTTDKGHKVSGTYEGNVEMTDKR
Download sequence
Identical sequences I3YJ32
WP_014774712.1.56960 gi|390945925|ref|YP_006409685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]