SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946213|ref|YP_006409973.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946213|ref|YP_006409973.1|
Domain Number 1 Region: 46-112
Classification Level Classification E-value
Superfamily PKD domain 0.0000000183
Family PKD domain 0.0033
Further Details:      
 
Domain Number 2 Region: 133-175
Classification Level Classification E-value
Superfamily PKD domain 0.0000106
Family PKD domain 0.0098
Further Details:      
 
Weak hits

Sequence:  gi|390946213|ref|YP_006409973.1|
Domain Number - Region: 214-320
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00786
Family CBM4/9 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390946213|ref|YP_006409973.1|
Sequence length 424
Comment hypothetical protein Alfi_0922 [Alistipes finegoldii DSM 17242]
Sequence
MKQLFFHLVPVLAFGLVLAACDNDSDEWTQPYEFAWSYGAESQFSVGKPATFTDLSLGVE
TREWSFEDATPATSTDPEPSVVFNSKGIKTVTLTIHFLNGQVQSESFDIEVFYPLSARIK
ALELTPKGCIRLDTPVSFGLTEVEGNPTSYQWTFEGGTPSSSTDPAPVVTWTSANKNGAR
ISCRLTRADDGMTTTVEQTFIVGNYPMLHPIPEKDYDPWRFELSSIGKWTLWNTTTSADD
LTTNTSIVSGGADGSKQALKVTLKPGVIYQLFTRDNWVCNAQLVAGQKYEVSFWQKTDAA
EGSLIVLTGIYNNLPSWSWNEYLQVLASDHWSIYFPDIPFEEQVEEMFGIWSNIEYPLTE
TITLPASPELMPSAEWKQVRFEFTATSAKYESLLNTYPQFALLSAGSADVNWYLDDIQIN
LIEE
Download sequence
Identical sequences I3YJX0 R5UWW2 R5W418
gi|390946213|ref|YP_006409973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]