SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946330|ref|YP_006410090.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946330|ref|YP_006410090.1|
Domain Number 1 Region: 34-285
Classification Level Classification E-value
Superfamily Nucleoside hydrolase 3.92e-33
Family Nucleoside hydrolase 0.00073
Further Details:      
 
Domain Number 2 Region: 351-488
Classification Level Classification E-value
Superfamily FwdE-like 0.00000000000000628
Family FwdE-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390946330|ref|YP_006410090.1|
Sequence length 492
Comment Inosine-uridine nucleoside N-ribohydrolase [Alistipes finegoldii DSM 17242]
Sequence
MTIRQCFFCRGLLAVILSAFLAPCHAHSGKARFHAVVDTDGAADDLRTLCMLLGNREVEV
LAVTTSEGALLPDSAAVRVRALLDSFYHEGVPVGAGRAVNAPAPAWRAHSGTVDWGDAAT
ATSGAGFPAASALIAETLGEEEEKVVFIALGALTNLYDVLRENPASGDRIDRIVWYNSRA
EPLSGANFETDSVAARYVLASGVPVTVVSANPACPVVVTPALIDSVAAVPNVYARKIAAT
HRTPPLAKLVGERHLEAWDDLVAVYLFAPELFSIRELNGTVRACELSDKSAAAEAQTRLT
AILRGKPDSESRVFYGFPVGGALYAADVVPIIDSAVARHGLSEWRAGVLTNELHGHLGIY
ATIGVKMGIRAREYFNIGVDDILVTTYAGHKPPVSCMNDGLQVGTGASVGHGLITVAEID
TPRPEARFTFKDKTIRLVLKPRYADRIRRDVKRGIELYGDLTEPYWQYVRALALRYWLDF
DRHEIFDMYVGD
Download sequence
Identical sequences E4M9Z0 I3YK87
gi|390946330|ref|YP_006410090.1| WP_009597091.1.56960 WP_009597091.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]