SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946387|ref|YP_006410147.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946387|ref|YP_006410147.1|
Domain Number 1 Region: 160-520
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.56e-129
Family beta-N-acetylhexosaminidase catalytic domain 0.00000134
Further Details:      
 
Domain Number 2 Region: 22-159
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 6.73e-21
Family beta-N-acetylhexosaminidase domain 0.01
Further Details:      
 
Domain Number 3 Region: 636-749
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000104
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390946387|ref|YP_006410147.1|
Sequence length 774
Comment N-acetyl-beta-hexosaminidase [Alistipes finegoldii DSM 17242]
Sequence
MKKLLLTLAAGIVLCSCGSHDPQIAIVPYPNHLETGRGTYRVTDRPVTCDSRTDERTQRA
VVGFAARLATVTGGTNPVTVADEVPASGIRFVTDESLPAEGYELNVDGEGIEVRASQFPG
FLYALQSLEQLLPAAVYGTEPAPDAAWEVPCVKIADAPRFAYRGMHLDVARHFFSVDEVK
RYIDVMAIHKLNTLHWHLTDDQGWRIEIKRYPELTAVGSIRKATVVRKEWGTYDGTPYGG
FYTQDEIRDVVKYAADRGVTVIPEIDLPGHMLAALTAYPELGCTGGPYEVWGRWGVADDV
LCPGREKTFEFLEGVLTEVMELFPSEYIHIGGDECPKVRWEKCPRCQAKIRQLGLKDDGE
HTAEHYLQSYVTDRIGKFLAQHGRRIIGWDEILEGRAPSDAVVMSWRGSEGGIAAAKLGH
DVIMTPNSHFYFDYYQSLDTDAEPFGIGGYIPMEQVYSYDPAFPELTPEQQKHILGVQAN
LWTEYVLSDEHLEYMLLPRLAALSEVQWCLPETKDWNRFIGSFRMDEIYSQMGYEFAKHI
FGVTASYAVDPEKGGVVMTLTTQGGAPIRYTLDGSDPTASSPLYKAPVTIGESCTFKAAA
LREGMQTPVYARKFDFNKATGRRIALNAAPTLKYTYGGASLLVDGYRGGPVYSNGAWIGF
LNEPLDVTIDMQGAKPYSAVTVESLVEKGEWVFPPSSVGVYLSDDGSEFTEAALMSVPQE
TAGSPDGVKPFKVLFPETSARYLRVVARTVDPIPAWHGAAGQKAHMFVDEIIVE
Download sequence
Identical sequences I3YKE4
WP_014775081.1.56960 gi|390946387|ref|YP_006410147.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]