SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946389|ref|YP_006410149.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946389|ref|YP_006410149.1|
Domain Number 1 Region: 7-276
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.26e-82
Family G proteins 0.0000555
Further Details:      
 
Domain Number 2 Region: 259-391
Classification Level Classification E-value
Superfamily Translation proteins 1.36e-25
Family Elongation factors 0.018
Further Details:      
 
Domain Number 3 Region: 391-466
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000000112
Family EF-G/eEF-2 domains III and V 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390946389|ref|YP_006410149.1|
Sequence length 527
Comment peptide chain release factor 3 [Alistipes finegoldii DSM 17242]
Sequence
MTLQEEITRRRTFAVIAHPDAGKTTLTEKLLLFGGAIHVAGAVKSNKIKKGATSDFMEIE
RQRGISVATAVMGFEYKGAKINILDTPGHEDFAEDTFRTLTAVDSVIIVIDGAKGVESQT
RKLMEVCRMRSTPVIVFINKLDRPSKEPFDLLDEVEKELNIRVRPLAFPISNGPTFKGVY
NLYEKNLSLFTSDEKLTADASTVEISDLASSELEAQIGDKFAAQLRSDVELVEGVYDDFD
RGAYLRGELAPVFFGSAVNNFGVRELLECFVRIAPSPCPAPTETRIVEPAEPKMTGFVFK
IHANMDPNHRDRIAFLKICSGTFERNKNYLHVRSGKQLKFSSPTAFMAEKKSIIDFAYPG
DIVGLHDTGNFKIGDTFTEGEKLKFTGIPSFAPEQFRYIENADPLKFKQLAKGVDQLMDE
GVAQLFVSSLNGRKIIGTVGALQFEVIQYRLEHEYNAACRWEPISIYKACWIESDNAAQL
ADFKRRKHTNMAVDKHGRDVFLADTSYGLALAQENFKDIRFHFTSEF
Download sequence
Identical sequences E4MA63 I3YKE6 R5V6B8
WP_009597160.1.56960 WP_009597160.1.9852 gi|390946389|ref|YP_006410149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]