SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390946413|ref|YP_006410173.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946413|ref|YP_006410173.1|
Domain Number 1 Region: 16-146
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.44e-22
Family Pentapeptide repeats 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|390946413|ref|YP_006410173.1|
Domain Number - Region: 168-200
Classification Level Classification E-value
Superfamily Rv2632c-like 0.0955
Family Rv2632c-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390946413|ref|YP_006410173.1|
Sequence length 223
Comment hypothetical protein Alfi_1137 [Alistipes finegoldii DSM 17242]
Sequence
MTQTELLKMIGSGAVRDLDLTGRELKNIDFKGCRVENVTFDECTLTECNFDGCGMERVSF
RKAVLRNCRFRRAKIAWSDFRYCEIERATFEEAEIRFCDLYRAMLTGIVIMRKARIGETS
LYYAYFGEGVNIRRENIADGRLLQQDLDAYRRFLIEWNTSGTGVRRNDRAEQSAWSPDAA
LHAGGHAQRRPDDDRHPAHGHLRLHPRQQDTQSVKPCSHCANT
Download sequence
Identical sequences I3YKH0
WP_014775098.1.56960 gi|390946413|ref|YP_006410173.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]