SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946534|ref|YP_006410294.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946534|ref|YP_006410294.1|
Domain Number 1 Region: 274-575
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.95e-47
Family beta-glycanases 0.0014
Further Details:      
 
Domain Number 2 Region: 10-164
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-35
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0048
Further Details:      
 
Domain Number 3 Region: 186-276
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000000153
Family beta-Galactosidase/glucuronidase domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390946534|ref|YP_006410294.1|
Sequence length 676
Comment beta-galactosidase/beta-glucuronidase [Alistipes finegoldii DSM 17242]
Sequence
MKRYIATLLLLAACASVQAREVFPLNEGWRFFFKSENSSDNARHVTLPHTWNTDTGACGY
FLETTANYQNDMYVPAEWASKRLFVKFYGVQNVADLFVNGYHVGAHRGGSTAFTFEITDK
IRFGEDNALLVVVSNNSRDDVLPASTDMNLYGGIYREAELILTGKTAVSPLHLGSEGVLV
RQNSVTSALVEGEAEIYLTSAGESTCMLTLDITAPDGRKVFTKRQKTRLDGRPVVIPFSI
ADPQLWSPSSPALYRVTASIGEETVTDSVTVRTGFRNIQVTTAGGLTINGERIPVHGVTL
YHDNAISGGAVLAQDYDADLQQIRDLGANALRSAVMPHAQYLYDRCDEQGLLVWVDSPLH
RSSFLGDVAYFATPQFEQNGIQQLQEIIAQNYNHPSVVMWGIFSRLWMRGDDVTPYLRRL
NDTAHAMDRSRPTVACSDQNGGLNFITDLIVWRQDVGWRKGSTDDVAVWRNQLQKNWSNL
RSGVCYGGSGFIGHKSYTAQTAPRSNWMPEERQTRFHEEYVKNLQNDSLFWGTWINNMFD
YGSARRPYGINGEGLVTIDRRERKDAYYLYRALWNERKPTLHIVDKRRSLRDRNRQAFSV
YSSVGAPTLFVGADTVAMTQYAACQYRSDSVEIQGIVQVKAVAGEQCDSVTLRVGNVLKP
KRQPVPRRTAGPQQTN
Download sequence
Identical sequences I3YKU1 R5UCR6
gi|390946534|ref|YP_006410294.1| WP_014775189.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]