SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946553|ref|YP_006410313.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946553|ref|YP_006410313.1|
Domain Number 1 Region: 5-277
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.04e-60
Family G proteins 0.0000656
Further Details:      
 
Domain Number 2 Region: 470-511,542-620
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.84e-36
Family Translational machinery components 0.00011
Further Details:      
 
Domain Number 3 Region: 624-712
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.35e-26
Family EF-G/eEF-2 domains III and V 0.00067
Further Details:      
 
Domain Number 4 Region: 262-393
Classification Level Classification E-value
Superfamily Translation proteins 8.08e-26
Family Elongation factors 0.00067
Further Details:      
 
Domain Number 5 Region: 393-465
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000000468
Family EF-G/eEF-2 domains III and V 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390946553|ref|YP_006410313.1|
Sequence length 718
Comment translation elongation factor-like GTPase [Alistipes finegoldii DSM 17242]
Sequence
MKNYSAKEIKNIVLIGAPGTGKTTLAEAMAFEGKVIDRRGSIETNNTLSDNTDIEHEYKR
SIYSTILFTEFMDRKLNIIDCPGSDDFCGSLFSAFKVGDVGVFLFNAQNGWEVGSEIQAR
YARLLQKPVIGVVNQLDADKANFEAAVESIRASSRVKPVIVQYPVNQGPEFNAFIDVLLM
KMYRFKDNDGHREELEIPAEELDKAQELNKELVEMAAEHDEALMELYFDKGTLTQDDIRA
GLKIGLSKREVMPIFCTSGKRDIGTKRLMEFIINVAPGPLKAPNFLSTDGEEIAADETAP
AVAFVFKSQVEQHIGEITYFRVIRGRIAEGTELVNTRTGNKEKVSQLFAVAGRNRIKVTE
LMAGDIGCTVKLKGTRTNDTLAAPSAPVTVEPIVFPEPRYRAAVKAKEQGDEEKLGKVLN
DAKFEDPTILVEYSKELKQTIIQGQGEHHLNILRTRIEKENRLQYDYIAPKIPYRETITK
VAQADYRHKKQSGGAGQFGEVHMIIEPYYEGMPEPKNYKVPGKGDMVVNPKTKEEYDLPW
GGKLQFYSAIVGGAIDARFMPAILKGIMEKMDEGPLTGSYARDIRVVIYDGKMHPVDSNE
ISFKLAARNAFKEAFRNAGPKIMEPIYNVEVLVPSDYMGAVMSDLQNRRAMIAGMESDKG
FDRLNATVPLAELYRYSTTLSSLTSGSATYSMKFSSYEQVPADVQDKLLKAYTDTDEE
Download sequence
Identical sequences E4M9B4 I3YKW0
WP_009596881.1.56960 WP_009596881.1.9852 gi|390946553|ref|YP_006410313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]