SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946596|ref|YP_006410356.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946596|ref|YP_006410356.1|
Domain Number 1 Region: 161-517
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.37e-121
Family beta-N-acetylhexosaminidase catalytic domain 0.00000158
Further Details:      
 
Domain Number 2 Region: 25-158
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 2.62e-18
Family beta-N-acetylhexosaminidase domain 0.016
Further Details:      
 
Domain Number 3 Region: 627-743
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000605
Family Galactose-binding domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390946596|ref|YP_006410356.1|
Sequence length 768
Comment N-acetyl-beta-hexosaminidase [Alistipes finegoldii DSM 17242]
Sequence
MKFSFHLLLACIALTACGESGKTTADYRIVPCPGEIAPGDGGDFELDARTRIVCTGDNDG
MRANAEFLAGYVESVVGSAPEITGPDGLCDDGRAVILRADAPGKGGEAYEIEVSENRITV
SGESDAGVFYGIQTLRKAMGAAKAAKVLFPAVRIADEPYLGYRGVMLDVGRTFYPVEEVK
RIIDLAALHNLNVFHWHLTDDQGWRIEIDAYPRLTETGAFRRDTTLAGEPGTFGGYYTKR
QIRDIVEYAARRYIEVVPEIDMPGHMTAALASYPELGCTGGPYVITSQPGVRRDILCAGN
PAVFDFVEKVLEEVIGLFPSKYIHIGGDESPRTRWRECPECQSLIRRAGLKADTRHSAED
KLQGYFNTRIEEFLARHGRRLIGWDEIVDGGMSPDATVMSWRGTAGGIRAADEGFDVIMS
PNSSLYFDYYQSANIDTEPPTIGGYIPLKKVYDTEPVPEELTPEQARHIIGVQANVWTTY
MRTDTILEHMLLPRLAALAERAWSDREKDFTDFMERLDRLVGFYDRDGYSHFPYFYDITG
AFTADYGRKAVGMTLSSLPGADIRYTLDGSEPTEESPLCTDTVWIGSPTAVRAVAVLPDG
RRSEPFREEVTFNKATMKPIRLLTAPHPKYAAAALNDGLRGKRVFTYGNWAGWQDDDMEA
VIDLGRQEEIAQVAFNALLDYGSHIMDAAGAKVWVSDDGETFREVYGEHYPEIPYGAVKR
ILRHEANFSPALRARYVKLRVMRSKQLPEAYFDRNLRPFLFIDEIYVY
Download sequence
Identical sequences I3YL03
gi|390946596|ref|YP_006410356.1| WP_014775228.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]