SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946655|ref|YP_006410415.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946655|ref|YP_006410415.1|
Domain Number 1 Region: 106-387
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.74e-39
Family Lambda integrase-like, catalytic core 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390946655|ref|YP_006410415.1|
Sequence length 403
Comment site-specific recombinase XerD [Alistipes finegoldii DSM 17242]
Sequence
MAKVKVKFRNSTVEGKAGVIYYQLCHKCQSRQITTGIRLFPEQWDALRERAVVPFAGLDG
EIAVVQRQIDGDLCLFRAIIGDFEARRVEYGLPDVVGRFRSFGRVTVFAFIEKQIACLRA
GGRLGTARNYRRTLNSFAGFLNGADIPFSLLDEQLVSRYDDWLRRRRIVRNTVSFYMRVL
RAVFNKAVREGIVSQSSPFRNVYTGVDRTRKRAVGEETVIRLRRLNLEHSPSLALARDIF
IFSYCARGMAFVDIAFLRKQDIAGGAICYVRRKTGQRLTIRIEPCMGDIIERYAPVTRTS
DYVFPLLNAEDPVRGFSQYQTALGYYNRRLKRLAELLGLEMPLSSYTSRHTWATTARNHN
VPLSIISAGMGHASEKTTQIYLASLESSVVDQANRSIIASLYV
Download sequence
Identical sequences A0A1Q6I4M9 E4M9F0 I3YL62 R5UIU6
WP_009596859.1.56960 WP_009596859.1.9852 gi|390946655|ref|YP_006410415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]