SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946661|ref|YP_006410421.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946661|ref|YP_006410421.1|
Domain Number 1 Region: 13-292
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 3.53e-60
Family Lambda integrase-like, catalytic core 0.0000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390946661|ref|YP_006410421.1|
Sequence length 298
Comment tyrosine recombinase XerD [Alistipes finegoldii DSM 17242]
Sequence
MAENTKKWEETGRRYRTYIKLEKRLSQNTVESYMRDLRQFAHFILRQYDVAPRKVEGTMI
ERYMAWLYDRGREKTSQARCLCGIRSFFNFLLVNDQIETSPAEFVDTPKFGRPLPDILTT
DEIDSIIATVDMRSTKGLRDSAMLEVLYSCGLRVSELTSLRLSDLFFGEGYIRVIGKGNK
QRLVPISNTARDKIQRYLEERRSARSGEETVFLNNRGGQLTRVMVFTILKRAVERAGIDK
HISPHTFRHSFATHLLEGGASIRQVQEMLGHESILTTEIYTHLDSDHLRRTLEEHLPI
Download sequence
Identical sequences E4M9E4 I3YL68 R5UCA5
WP_009596903.1.56960 WP_009596903.1.9852 gi|390946661|ref|YP_006410421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]