SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946668|ref|YP_006410428.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946668|ref|YP_006410428.1|
Domain Number 1 Region: 308-596
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.27e-58
Family beta-glycanases 0.013
Further Details:      
 
Domain Number 2 Region: 41-214
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.48e-55
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.01
Further Details:      
 
Domain Number 3 Region: 216-310
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000000000863
Family beta-Galactosidase/glucuronidase domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390946668|ref|YP_006410428.1|
Sequence length 606
Comment beta-galactosidase/beta-glucuronidase [Alistipes finegoldii DSM 17242]
Sequence
MKKNILLTAAALLTTLAGAAQWQPAGDRIGTEWGEKLDPQNVLPEYPRPQMTRTQVQDGW
QNLNGLWNYAILPMGETPEKYDGQILVPFAVESSLSGVGKRLGDRNELWYNRTFTISPKW
NGKRVLLHFGAVDWKADVWVNGVCVGTHTGGFTPFEFDITAALKKGDNELKVRVWDPTDA
GCQPRGKQVNRPEGIWYTPVSGIWQTVWLEAVPQQYIRNIRTTPDLDRKLFRVETAACGA
QPGDVIEVRLYDNGTKVAEGRALSGAPVELNVAEPKLWSPASPFLYDMEVALVRNGRKVD
EVQSYTAMRKFSIGRDENDIVRLELNNEPLFQFGPLDQGWWPDGLYTAPSDEALAFDVVK
TKELGYNMIRKHVKVEPARWYYHCDKLGMIVWQDMPNGDQGPQWQMHNYFNGAEKHRSAE
SEANFRKEWKEIIDCLYSVPSIGVWVPFNEAWGQFKAPEIAEWTKAYDPSRLVNPASGGN
HYLTGDILDTHHYPHPRMTLLDTNRATVLGEYGGIGLVMKEHLWEPDRNWGYVRLNSPKE
VTDEYEKYADMLYKLIGRGFAAAVYTQTTDVEVEVNGLMTYDRKVMKVEPERIRRINERI
CNALNK
Download sequence
Identical sequences I3YL75 R5UIW2
WP_014775284.1.56960 gi|390946668|ref|YP_006410428.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]