SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946707|ref|YP_006410467.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946707|ref|YP_006410467.1|
Domain Number 1 Region: 235-633
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.9e-61
Family beta-Lactamase/D-ala carboxypeptidase 0.00072
Further Details:      
 
Domain Number 2 Region: 58-126,170-282
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.03e-16
Family Penicillin binding protein dimerisation domain 0.0072
Further Details:      
 
Domain Number 3 Region: 701-754
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000916
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390946707|ref|YP_006410467.1|
Sequence length 754
Comment cell division protein FtsI/penicillin-binding protein 2 [Alistipes finegoldii DSM 17242]
Sequence
MKEERSKIKSDILLRVRLLYVLFILAGAVVLGRLVWVQLFSSEVAYNAERLASRIFTEET
IPAQRGSILSRGGAPLATSIFRYQAAFDFASPGLDSLKTFREQSDSLAKLLAAFFRDKSA
AEYSRKFREEHARHYRLVNGRDTTYLRSEGWFSRLMDRLRGEEFATRRIYDTIRDHTPVN
IFPREVDYAEWQTLRRYPLLNWNMGMVYRLVERDQRVYPQGELARRTIGLTGDKGNYGIE
EAYREELAGRDGKALRQRIARGFYGRVAGGGHEDPEDGYDVVTTLDLDLQDVADKALRRQ
LEAQNAIWGTTIVMEVHTGEILAMANLGRAGTEGAFYERENYALGRSMEPGSTFKLATML
TLLDDADMSPQTAYDTHNGDPVTVGPAKNIRDSHRGDHVIDFRRAVASSSNVYFAKAIWE
RYGITGKKQEYSDFLHEKLRLGQTVGLERLGERAPSITTDWKVPDPGVMLVKMSYGYRVR
LAPIQMITFYNAIANGGKMISPVLVRELRRGDRVEERFESRTLASSICSRSALREVQRCL
ELVCTEGTASLYFRDTARLRVAAKTGTAQITDARSREGRYYLGSMIAYFPADNPRYTVLT
TIETRAQAGKAYYGGPLAGPVVKRMVDYIYNRNRDWYGRVERHGPRRHPDRIKGGDIAQI
RRVADKLSPRASFDHRTGWGRVQVDSLSNVVITSLPAETGTMPDVRGMGLKDALFVLESR
GLKVRFSGRGAVVRQSVAPGARITPGATVAITLN
Download sequence
Identical sequences I3YLB4
WP_014775313.1.56960 gi|390946707|ref|YP_006410467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]