SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946742|ref|YP_006410502.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946742|ref|YP_006410502.1|
Domain Number 1 Region: 119-386
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.38e-41
Family Lambda integrase-like, catalytic core 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390946742|ref|YP_006410502.1|
Sequence length 406
Comment site-specific recombinase XerD [Alistipes finegoldii DSM 17242]
Sequence
MARSTFKVLFYVNGSKEKDGIVPIMGRVTINGTVAQFSCKQTIPKTLWDAKGNRAKGKSA
EARNINLALDNIKAQIIKHYQRISDREAYVTAEMVRNAYQGVGSEYETLIKAFDKDCANF
LKRVGKDRSIGTYKVMVRARNYVAAFIKSFYRRTDMSMLELTPDFIKEFAAYLTAERGLK
NATIWLNCMWLKGVVMRAHYNGLIPRNPFAQFHISPNVKEREYLTEDEIKRIMAHEFDNP
TLALVRDLFIFACFTALSFVDMKELTTDEIVEVNGEKWILSKRHKTNVPFQVKLLDIPLQ
IIERYKYLSEDKLVFGKINYWTMCKQLKKVMAECGIEKQISYHCARHTFGTLALSKGMPI
ESVSRVLGHTNIVTTQIYAKITTQKLDNDLTMFGNKLNASFGSVTP
Download sequence
Identical sequences A0A2J9HZF2 A6LDV5 I3YLE9
WP_011966713.1.47855 WP_011966713.1.56960 435591.BDI_2138 gi|150008748|ref|YP_001303491.1| gi|390946742|ref|YP_006410502.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]