SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946823|ref|YP_006410583.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946823|ref|YP_006410583.1|
Domain Number 1 Region: 59-313
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.91e-30
Family Type II chitinase 0.02
Further Details:      
 
Domain Number 2 Region: 516-633
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000306
Family Galactose-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390946823|ref|YP_006410583.1|
Sequence length 636
Comment glycosyl hydrolase family 18,F5/8 type C domain-containing protein [Alistipes finegoldii DSM 17242]
Sequence
MKNILKHAVVCLVLAAAVASCTKETTPERINIQHPDQQSPILRDNAYYQNLRAYKQTKHK
LAFGWYGSWTAVGASYQSRLISAPDSMDIISIWSQWHTLTPQQMADKEFVQKTLGTKVTY
TIFSDKLPEPFLEIGNGEYTDEAIEAYAKAYCKDSMDKYQYDGIDIDYEPGYGASGPFVG
HDNALFTKLINAMSKYVGPKSGTGRLLIIDGVPYAVDRSVVDCFDYGIVQAYASSGYTDL
QNRFNNADAKGWKPEQYIFAENFESYWKTGGVDFTDREGNRMPSLYGMATFNPTQGAGAG
FGAYHMEYEYGNSAMPYQFMRNAIQMANPAGGWKTPIDVAFSSNQSSNFSFVVEDDGSVT
GTMQDKVSLSFSRPVVSGMQLTLGVDNSLVAVYNDENGTEYETVDPSLVKMEPIQCAENQ
VFSPDATITLDPKSIEKGYYLIPVVISPISDAGYAVKEGSVHYIFVTKVAMDVEIGATTL
DGSKIAPTSAWTITCCQGTATSGATGVWNCDSAAQKAAMFDGKLDANCWYANSASYSWGN
GGNFTIDMGEVNDVTGLRWHIHYQDSEPQCTDLTYSEDGNVWYSLSAGVPFTPVLSDNWK
WVKFKRTVKARYIRVYVGLVTGWTSMNEAEIYGPAN
Download sequence
Identical sequences I3YLN0
gi|390946823|ref|YP_006410583.1| WP_014775396.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]