SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946866|ref|YP_006410626.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946866|ref|YP_006410626.1|
Domain Number 1 Region: 142-453
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 2.94e-23
Family Lambda integrase-like, catalytic core 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390946866|ref|YP_006410626.1|
Sequence length 499
Comment site-specific recombinase XerD [Alistipes finegoldii DSM 17242]
Sequence
MEIEKTNKVTEMAKKNGKSNARGEKCLAKFTAANGNVYGSLTLDIRKAGDYSQPLPVAVR
VCHGGQKIFLRLGKSYTMEEWLVLCDYEKSGRRIQLAERNDMKNLMDRVEQMANQLISEN
NFSLRKLQDRFQGKKDDDSTIITVWDSYIQSKTNEGKVGSARCSKDVRNRFVKDLGTDVS
FADINRDFILKWVKNMKKNELSTTTIAIALRSLRTIINMCIANGLMKGDTKEMFKDTGYN
KAQSRKHEFLDVATMRKLYDFWKADEAKDKDGNELFLGREKYAIFRDLGLFLFMYLGNGQ
NLADTLRLTYDELYYATHGKQLRFLRHKTRERNESASEVIFPVTPEIQEILNRYGNVPKL
GRRVFPIMSELITPEQEIWVIQRYNRYIREHMAKVAKLLDMEQVPSPTWARHSFATNLNN
SGVVPYKYISDSMGHSGGGDITSNYIGAYPLAKMLEYNHYLLNEKSKESTPVVDKKALLE
MLKGLSEEERTELMANLSD
Download sequence
Identical sequences A0A1Q6FXS3 I3YLS3 R5UD98
WP_014775432.1.56960 gi|390946866|ref|YP_006410626.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]