SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946868|ref|YP_006410628.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946868|ref|YP_006410628.1|
Domain Number 1 Region: 860-1023
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-36
Family Histidine kinase 0.0024
Further Details:      
 
Domain Number 2 Region: 1047-1177
Classification Level Classification E-value
Superfamily CheY-like 5.83e-35
Family CheY-related 0.0012
Further Details:      
 
Domain Number 3 Region: 358-580
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 6.54e-19
Family SGL-like 0.013
Further Details:      
 
Domain Number 4 Region: 799-870
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000961
Family Homodimeric domain of signal transducing histidine kinase 0.0013
Further Details:      
 
Domain Number 5 Region: 167-430
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000114
Family Quinoprotein alcohol dehydrogenase-like 0.03
Further Details:      
 
Domain Number 6 Region: 28-170
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000252
Family Serum paraoxonase/arylesterase 1, PON1 0.051
Further Details:      
 
Domain Number 7 Region: 1247-1292
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000582
Family AraC type transcriptional activator 0.024
Further Details:      
 
Weak hits

Sequence:  gi|390946868|ref|YP_006410628.1|
Domain Number - Region: 1197-1244
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0026
Family AraC type transcriptional activator 0.065
Further Details:      
 
Domain Number - Region: 732-759
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00971
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390946868|ref|YP_006410628.1|
Sequence length 1295
Comment signal transduction histidine kinase [Alistipes finegoldii DSM 17242]
Sequence
MGGRIHIWMACVVTAFFAVARANAGAYTFKSYQVENGLSQNSVLSILQDREGFMWFGTKD
GLNCFDGYSFKVYRRQSGVETSLGNNFVFSLREDSHGRFWVGTGRGVWLFDKERETFRKF
RVEVSGRDILTAQISAIMEDDAGDIWLATHGQGLFRIDRNLACTHHFQTPQIPSNFIGSV
VQDKMGGIWVGTVGKGIVMLDPATSRVDSLPEYVSEGIRDKVISSLYCDDNNNVWVGTSK
EGLHCINNRALRVQHYLDKSILNIRSITQYLDDVIVMGSDNGLVMLDTSTGEYRLTNKSL
NSNLSDNSIFSIIRDRENSLWIGTYFGGVNYYSPLINRFEHYYSSNGHRNFNGNIVSQIR
QDKNGKIWIGTDDKGLSLFDPQTGQFEPSALCGKVTYHNVQAILCNDDYLWVGLYNKGIN
RIDLKTGRVKNYVSRPGDSTGIDDSNIFAITRLSTGELLFATPIGVNVYNAAEDNFTRIP
QLVNVFVKSILEDYLGNLWFATNNEGIWCRTKSGQWCRYVNNPADSNSLSYNAVNYIYED
RKNRLWFCTDGGGVCLWNHRDKTFRTIDENRGLPNNVVYAIVDDLNGHLWVSTNKGLAAI
SEEDWTVRTYNSSQRIQNVLYNYNAVLRDRDNYLYFGGVNGFVRFDPREITPNDFTPAVK
ITAVSVLNRDIPVSEGGDKRFVLKRNQSTFRFDFVLLSYVSPPDNLYAYKLEGFDRDWTT
VQGYPHAHYMNIPSGKYRFRVRAANSDGVWNDRSDEIEIVVKRPFFSSVAMLVLYTALLL
AGIWFWVRRFRSRVKARSEKKFLEDKINFFTNIAHEIRTPLSLITAPLENIIKSGDGTVQ
TRDNLHVIERNSNRLLELVNQLLDFRKIEEEMFILNRERTDINGIVRKVYAQYEYEARAK
NIDLRIELPGEEVGCLVDAEAIFKVISNLMSNAMKFTRDTIWLELCRDEGTAVVRVRDNG
AGLDDRDAGRIFDPFVQGSNNTLSAGSGIGLALAQALARKNKGEIELDRSCGQGAVFVLT
LPLAEAAADESLAKHATHSFGGAAEDNRQRILVVEDNDELREFICRSLSDQYTIASAVDG
MQALKVLDNEGVVDLVISDVMMPRIDGLELCKRIKNDPAYSHIPVILLSAKVDQSVKIKG
FEQGADVYIEKPFSMDQLKAQIGSAIENRMRLRDNFVRSPLQYLRENHGGCDIQFLNKLN
DTILSNLTNTEFSINGLAELFCMSRSSLHKKIKALTGLTPNDYIKLIRLNKAAELLSSGS
YKVNEVCYLVGFNTPSYFAKCFYKQFNKLPSSQLD
Download sequence
Identical sequences I3YLS5
WP_014775434.1.56960 gi|390946868|ref|YP_006410628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]