SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946957|ref|YP_006410717.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946957|ref|YP_006410717.1|
Domain Number 1 Region: 5-286
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.71e-98
Family G proteins 0.0000000803
Further Details:      
 
Domain Number 2 Region: 270-408
Classification Level Classification E-value
Superfamily Translation proteins 1.13e-34
Family Elongation factors 0.00014
Further Details:      
 
Domain Number 3 Region: 483-603
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.87e-34
Family Translational machinery components 0.0000979
Further Details:      
 
Domain Number 4 Region: 608-695
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 8.63e-29
Family EF-G/eEF-2 domains III and V 0.00011
Further Details:      
 
Domain Number 5 Region: 406-484
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.35e-25
Family EF-G/eEF-2 domains III and V 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390946957|ref|YP_006410717.1|
Sequence length 704
Comment translation elongation factor EF-G [Alistipes finegoldii DSM 17242]
Sequence
MATRDLNYTRNIGIMAHIDAGKTTTSERILFYTGKTHKIGETHEGAAVMDWMVQEQERGI
TITSAATTAFWNYKGNQYQINLIDTPGHVDFTVEVERSLRVLDGAVATFCAVGGVEPQSE
TVWRQADKYNVPRLGYVNKMDRTGADFLAVCAQIKEHFGATALPVVLPIGAEDKFEGLVD
LIYNNAIYYYDDKTVRDNFELKEIPESMKAEAAEWRAKLIEEVAATDDALMEKFFEDPDS
ITAEELLAAIRKATISMQVVPMLCGSSFHNKGVQKLLDYVMAFLPSPLDVPAVTGINPKT
EKEETRNASEDDPFCGLAFKIATDPFVGRLAFVRVYSGKLDAGSYVLDTRSGKRERISRI
YQMHANKQNPMETVGAGDICAAVGFKEIRTGDTLCAENAPIVLEQMTFPEPVIGLAVEPK
TQKDLDKLGIALGKLAEEDPTFTVHTDEDSGQTVISGMGELHLDIIVDRLRREFGVEINQ
GAPQVNYKEALTKTVQHREVFKKQTGGRGKFADIIFEIGPADEGQIGLTFVDEVKGGNIP
KEFIPSVQKGFASAMDNGALAGYKMDSMKVTLKDGSFHPVDSDQLSFEIAARNGYRAAAP
KAGSVILEPIMSVEVVTPEESMGDIIGDLNKRRGQITGMESKGTARVVKAKVPLSEMFGY
VTVLRTISSGRATSSMEFSHFEEVPANLAKEIIEKASGKRKDIE
Download sequence
Identical sequences E4MBH2 I3YM14
gi|390946957|ref|YP_006410717.1| WP_009597621.1.56960 WP_009597621.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]