SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946967|ref|YP_006410727.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390946967|ref|YP_006410727.1|
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 4.84e-18
Family Ribosomal protein L29 (L29p) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390946967|ref|YP_006410727.1|
Sequence length 62
Comment 50S ribosomal protein L29 [Alistipes finegoldii DSM 17242]
Sequence
MKSAEIKDISIKDLQERIETEKAQLAKLKVQHAVSPVENPSIIKKNRRDIARMLTILRQK
NA
Download sequence
Identical sequences A0A174DMB8 A0A1Q6F0U5 A0A1Y3QV01 E4MBG2 I3YM24 R5V4D6 R6YBE8
gi|390946967|ref|YP_006410727.1| WP_009597619.1.33938 WP_009597619.1.56960 WP_009597619.1.6197 WP_009597619.1.76885 WP_009597619.1.82919 WP_009597619.1.84583 WP_009597619.1.90853 WP_009597619.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]