SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390946992|ref|YP_006410752.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|390946992|ref|YP_006410752.1|
Domain Number - Region: 119-198
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000911
Family Fibronectin type III 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390946992|ref|YP_006410752.1|
Sequence length 567
Comment hypothetical protein Alfi_1736 [Alistipes finegoldii DSM 17242]
Sequence
MKKLLLFPCLLLALGLSSCESSDDEIMSIELVSPKKLAVTTELATASFKWDAVAKAEGYA
YALDNSTEYTTIDAATTTLKLTRLSRGSHTFRIYAVGNQEHTTDSAERTVDFDIDPTLPT
PAPSCTRGESADEVVVTWQAVKGAIGYAYKFNDETQWTEVGADVLKITKSGFDPEAKNTF
TIYAKGQLPDSEDSEELTLPFQLIDTSEGVWARTSDGSLYELKESESGIYTAAITCKASD
DITILIENTPYGFTAYSGNGGIGTVNSVYATVPFYTYPAAVYYVRESLGQMTAKTEDADI
NKFWVNVSGSTCKIDVEIDCTNADKTPRYRLKLVENEDPSIILEQYFDLMVYGGDWIQTG
KVASSGRKLASTSPAAIDGTEPATATASYTTFGINISSDKDAAPAYLANRGLTDWGIKYC
YEFPGYVRLSNSASGSNMYYGVLTTPKLSKLTAASIVTVTFDAVRFASEHDIPVKVLNAG
TIASAQVVVEGSGSAASIAPESGGKSINITSAHCPKHGNEALKKWSNFSITIEGATAETQ
ICWDTTGAGSTSANGRICLDNIVVRKN
Download sequence
Identical sequences E4MAE0 I3YM49 R5UN34
gi|390946992|ref|YP_006410752.1| WP_009597174.1.56960 WP_009597174.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]