SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947087|ref|YP_006410847.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947087|ref|YP_006410847.1|
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 3.53e-49
Family Lambda integrase-like, catalytic core 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390947087|ref|YP_006410847.1|
Sequence length 300
Comment site-specific recombinase XerD [Alistipes finegoldii DSM 17242]
Sequence
MLTEFIRYLSAERRYSPLTVRNYKHDVEQFLAWLDCDESRFDPRSVTTEQIREWIIFRTE
EGKLSAGSMNREVASLRAFFRWLHRTGAVEKDIFRMISTLKTSRRLPAFVPESRMTTIVS
ECGPDSEDFQTERNSLIILMFYACGLRLAELVGIDRSDFSADYTSLRVRGKGDKQRMVPI
LEFLREKILHYLGLIERQNICISSEKALFLTHKGKRISRSVVYRTVQEELTRAGVQGKKS
PHVLRHTFATHLLNGGADMREIQELLGHASLQATQVYTHNSIARLREIYAKAHPREKGGK
Download sequence
Identical sequences A0A1Q6G1V1 E4MA50 I3YME4
WP_009597134.1.56960 WP_009597134.1.9852 gi|390947087|ref|YP_006410847.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]