SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947093|ref|YP_006410853.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|390947093|ref|YP_006410853.1|
Domain Number - Region: 71-208
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.000732
Family Tricorn protease N-terminal domain 0.028
Further Details:      
 
Domain Number - Region: 19-71
Classification Level Classification E-value
Superfamily Fibritin 0.0314
Family Fibritin 0.01
Further Details:      
 
Domain Number - Region: 318-405
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0936
Family Fibronectin type III 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390947093|ref|YP_006410853.1|
Sequence length 713
Comment hypothetical protein Alfi_1848 [Alistipes finegoldii DSM 17242]
Sequence
MKKFALWSLALLLTFAAACSDYDDTDLWNSVNDIKKRVEALETAVAKLNSDVSAMQTLIE
KLNEKVYVSKVETNADGSYTIYFTDPENTKITITDGKDGAAAPVIGVAKDTDEIYYWTLT
SGGGEPEWLLADGKKIPVTAAAVVPLLKIDDKGFWIISCDKGATWNYITDDKDQPVSALG
QGGVSDSFFKEVTQDGAYAYFTLMDGTTITVAMRSDFYLLVKMAPALGTYAYGENKTYET
ESVGVNDVVLTKPTGWVVSYADEVLTIKAPAEEAVCETEGEIAVIYFGDNDRSSLVKMKV
KIDKDYTGVTEGDNFTLEITEVGDTRVRAAITPKDPEMSYYVYPYDPAKSDEACITQLQK
RFKADIVDGPEYVDYFFKGAKTDYRYSGLTPGESYDLSVVGVKYDLTAKTLDIVTPLMRV
PFSTKAPEIINTAYLMTLSDISWYGAKCAVHPSDDLPYFCTFVKKSTFDMAYDDADFAQT
YIDDRYLWPYYGELSDGILLWSDFTATGDLAFSSPGFMRRDPLYISEDIYPLEANTDYYA
VAFGCNENGEFSNSRVSRKLFHTKAFTPTEACTFTIDVTVDKQDLAIKVIPSDKNTSYIT
FIDERDTYRDNFATPRQYPPYDLYWRMQGLEAGQTIGDDDCFYTGDAAYNVVSLKAASAY
IVFAYGCSADGRITTEPEIVEVHTKGTVDQPDLNSAAKHRRTVSARPAYRVIR
Download sequence
Identical sequences I3YMF0
gi|390947093|ref|YP_006410853.1| WP_014775572.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]