SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947094|ref|YP_006410854.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947094|ref|YP_006410854.1|
Domain Number 1 Region: 354-509,554-676
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.45e-87
Family beta-glycanases 0.000000272
Further Details:      
 
Domain Number 2 Region: 789-1073
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.83e-68
Family beta-Galactosidase, domain 5 0.00012
Further Details:      
 
Domain Number 3 Region: 29-230
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-64
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00000802
Further Details:      
 
Domain Number 4 Region: 672-780
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 1.58e-21
Family beta-Galactosidase/glucuronidase domain 0.006
Further Details:      
 
Domain Number 5 Region: 233-352
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000000000151
Family beta-Galactosidase/glucuronidase domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390947094|ref|YP_006410854.1|
Sequence length 1091
Comment beta-galactosidase/beta-glucuronidase [Alistipes finegoldii DSM 17242]
Sequence
MNRLLAILLCGTTLCTAAAASERNAPADQFVNALRRLPARATSYSYSSEQDALAGDRTLS
RIQSLDGMWKFRFAEDVSRSPADFWLPGADLTGWDEIPVPSCWEMQGYGYPIYTNVVYPF
EFKPPYITRDNPTGCYVRTFSVPEAWSGNRVTLHFGGVYSGFYVWVNGALAGYAEDSCLP
SEFDITGLLQPGENRLAVQVFKWTDGSYLEDADHWRMAGIHREVFLSAKPDAAIGDFGVR
TIFDADMRDALLQIRPAIDLREGASAAGWQLGARLYAPDGTPSGRELTLPVEEILAEAYP
QRDNVYFALLEERITAPEKWSAENPALYTLVLTLRDAAGKLAEARSCKVGFRDVRLRGRE
MLVNGVPVKLCGVNRHDHDQYGGKTVSRESMEEDVRLMKRLNINSVRTSHYPNDPYFYEL
CDRYGLYVVDEANIETHGKGGLLSNDPQWITPFLERVSRMVIRDRNHPSVIMWSLGNESG
CGPAHAAAAGWAKDYDPTRLIHYEGAQGQPMHPLYVPLKRTSAAAFTSVMAADNQPAAGQ
VKKPQNGGNPTDPAYVDVLSRMYPTAAQLEQMALNPMLDRPVMMCEYAHSMGNSTGGLND
YWKLIRTHAGLLGGHIWDWVEQGLVKKDAQGRTYWAYGGDFEPAGEHNDAAFCCNGIVNP
DRTLKPAALECKYVFQPVEFTASDLAAGKIAVRNRNFFAGTERYDFTWEISTDKGVLQHG
SFEVPPTAAGCRSEAAIAFRLFKPEPGAEYLLRVQAREKRRTPYAEAGYAAAEEQFALPV
YKEPVRSAPKGRASVAQDDEFIVLSAAGSRTEIDRRSGYVVSHSVRGCKLISAPLRPNFW
RASTDNDWRGWRVGKIAGCWKEAPERLQTVSVRIDESAGSVTVEKAIPDSVRLTLTYTLD
GAGALAVDYKLDISDRMPEPLRVGLQTCVPNTLERIAYFGKGPQENYSDRCEGAFLGLYR
STPEKFMHSYITPQENGNRCDVRWLSLTASDGRGVQFVGAEPLSVSVWNCTQESLDKARH
SNEVEPLADALTVNIDRTQTGVGGTDTWSLKARPSDQYRLLEKHYACRFTIIPCNGEAET
IRNGRSLFRNQ
Download sequence
Identical sequences I3YMF1
gi|390947094|ref|YP_006410854.1| WP_014775573.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]