SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947096|ref|YP_006410856.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947096|ref|YP_006410856.1|
Domain Number 1 Region: 319-678
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.47e-101
Family beta-glycanases 0.0000000461
Further Details:      
 
Domain Number 2 Region: 24-215
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-50
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00000598
Further Details:      
 
Domain Number 3 Region: 217-319
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 1.35e-18
Family beta-Galactosidase/glucuronidase domain 0.0014
Further Details:      
 
Domain Number 4 Region: 679-776
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000000000216
Family beta-Galactosidase/glucuronidase domain 0.0042
Further Details:      
 
Domain Number 5 Region: 780-854
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.000000000000345
Family beta-Galactosidase/glucuronidase domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390947096|ref|YP_006410856.1|
Sequence length 864
Comment beta-galactosidase/beta-glucuronidase [Alistipes finegoldii DSM 17242]
Sequence
MKRLLLILWLLTAAAGSRISAAGRTELNQGWKFRQYGLGEWLPAAVPGTVHTDLLANGQI
PDPFYGSSQSDLQWIDKTDWEYCCTFDAPELASYDNVRLVFEGVDCYADIRLNGELLHRT
GNMFRTWKSDVKGLLKSRNNRLHVVFHSPVMQGLKNMAAYGGRLTANNDLGALGGLGPNK
VSVFTRKSGYQYGWDLAPRYVTSGLWRPVALEAWNEARVEDFHVRTRSTGPRKAQMSASA
ALRTDAAGCYRIRILLNGKSILTADKTLDAGTHSIEEPFEIPSPRLWYPNGMGEPYLYDV
ELVLEKEGRELDRTAVRCGVRTVSLRCRDDADGRGRGFGFEINGIPVFCKGSNYVPADAF
LPRISREKTEFLVRSAAQANMNMLRVWGGGTYESDDFYEMCDRYGIMVWQDFVFACNMYP
GSAQIYADIRAEAEDNVRRLRNHPSLVLWCGNNEIDVAWKPHDKRNSRFRKFYTEEEAEQ
FDRVNETIFRNILPGVVDSLCGGTVPYWHSSPSPGWGLDTADRWRYGDVHNWDVWHKGDP
ISAYNTQIARFISEYGLQSYPELSSVERFIPEGERRLASPSMTSHQGDRKKGDARMLEYV
DRSYLRSDDFARTLYLSQLMQAEGMKTAMEAHRRNMPYCMGSLIWQLNDVWPCASWSGID
YYGRWKAMHYFVRKACEPVVVSPYIQGDTLDIFVVSDLRKPLRGVMKLTLTDFSGNELKS
SSHPVTVGAAASQRALRYGVRDYLDGADPGNAVLVCEFRSDKTAYRTLQYFETMKNAALP
AAAVRIRAEKPDAATCRITVSSDKLAKNLTLHYRGTAGIFSDNYFDLLPGESRSVTLTAP
EDAAEILRHIECMALNPETTIIKL
Download sequence
Identical sequences I3YMF3
gi|390947096|ref|YP_006410856.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]