SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947186|ref|YP_006410946.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947186|ref|YP_006410946.1|
Domain Number 1 Region: 136-224
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.0000000000000111
Family Middle domain of MutM-like DNA repair proteins 0.009
Further Details:      
 
Domain Number 2 Region: 3-121
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.00000000000173
Family N-terminal domain of MutM-like DNA repair proteins 0.0028
Further Details:      
 
Domain Number 3 Region: 230-273
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000014
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390947186|ref|YP_006410946.1|
Sequence length 276
Comment formamidopyrimidine-DNA glycosylase [Alistipes finegoldii DSM 17242]
Sequence
MLEIPESYSFARQAADMLSGRTVTDVFNATHPHKFTWYLGDPADYRARLVGKTVRAAEGH
GAFIDMLLDDETHIALSDGVNLRYHAPGAEVPPKYQLLIAFDDDSFLVFTVAMYGGIIAF
RKNFDNPYYLGALSKPSPLDDAFDEACFGRLISDAKSNLSAKAFLATEQRIPGLGNGVLQ
DILFKSHIHPKRKLATLGDAELGRMYSSVKSTLRDMADRGGRDTEKDLLGKPGGYKTLLS
KNTFAEPCPGCGGAIVKEAYLGGAVYYCPVCQPLIK
Download sequence
Identical sequences I3YMP3 R5UW46
gi|390947186|ref|YP_006410946.1| WP_014775652.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]