SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947216|ref|YP_006410976.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947216|ref|YP_006410976.1|
Domain Number 1 Region: 236-584
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.09e-83
Family beta-Lactamase/D-ala carboxypeptidase 0.00034
Further Details:      
 
Domain Number 2 Region: 45-234
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.31e-32
Family Penicillin binding protein dimerisation domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390947216|ref|YP_006410976.1|
Sequence length 608
Comment cell division protein FtsI/penicillin-binding protein 2 [Alistipes finegoldii DSM 17242]
Sequence
MRDSEGFVRMRTLQCVVLFVFLLIGGRLAYIQLIDSRYNELAKANVLRHVVQYPPRGEVF
DRNGEYLVQSRECYDLMVIYSEIDKKGFDTLRMCEVLGLSREKLEKELANARMRPRAPRV
VTSYISKEDKLRFDECNFRGFYAVYRTVRRYPRKVGGNLLGFVGEVNADFLKRHPDYKSG
DYVGMSGVESAYEPLLKGRKGVKIQEIDTHGAIKGSYMNGVYDSLPEPGRYLVSTIDARL
QLLGEELMRGKVGAAVAIEPSTGEILMMVSSPTYDPDELVGRERGNNYMKMIYNKRHPLF
SRAVKAKYPPGSTFKLVQGLIGLQEGVLRPSDLHVCHEGYQVGRRRMKCHAHASPLDLRF
AVATSCNAYFCYVFRDILDNRKYESVKDGYDVWKEYVESFGFGRKLGSDFLDEGNGYVPD
RSYYDRQYRGSWNSLTVISLAIGQDALGCTPLQLANLAAIVANRGYYYIPHIVKKIEGQD
SLDRRFYERHYTKVDPKHFEPIVDGMWRGVNVGGTSTAARLEGLDVCGKTGTAENPRGRD
HSTFLSFAPKDNPKIAISVYVENGGFGASAALPIASLLEEYYLTDTIRRPALLEHIKNMN
IYYPSYDR
Download sequence
Identical sequences I3YMS3
gi|390947216|ref|YP_006410976.1| WP_014775676.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]