SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947603|ref|YP_006411363.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947603|ref|YP_006411363.1|
Domain Number 1 Region: 389-535
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000255
Family CBM4/9 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390947603|ref|YP_006411363.1|
Sequence length 538
Comment carbohydrate binding protein [Alistipes finegoldii DSM 17242]
Sequence
MDILIKTDRRPVSGIRSMLFLIAAIFLLPGCSSASDTEIPDPEPPGPEPLETGTLLPDNI
TLVARVTGRSESGETIPNPNRTDARFNIGRTDYNNMWDAGNGTVMCAFGDNFDYGGGNWK
SNAIALSSDRDLTDGLYYSGMLMDGNAVKEIVVSRAKTGQYPDGSEYEVTCIPTGGIAVG
TRQYLNYMSIHDWTPTGDNDYWSVNYSEIVYSDNYGTAWTRSGVKWNADSNFTQVAYLKE
NGLIYMYGTHSGRYGNVYLARVSETKLLDKSAYEYWTGGGWERNEQAAEPVARGTASEMT
VAYNSRYKRYMMMYLSVNQRAVVYRDAPSPEGDWSGEKIIMYEDGNALYAPYIHPWFNED
DELWFVISHAVPTWNVFLMRADLNWDQAGINLLAEGGFEEHPTQALSYKTMWHVNAAALT
SRDAHSGKIACRFSNTNSGQWQDVCTQTVSLQQNADYSIECWVKSEEVLPEGAYVGVRLT
DGTIHDITGTAQAGEWTRFGCEFNAGQAVSADVFFGVWGAPEMTLTVDDICLKPVKTE
Download sequence
Identical sequences I3YNW0
gi|390947603|ref|YP_006411363.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]