SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947639|ref|YP_006411399.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947639|ref|YP_006411399.1|
Domain Number 1 Region: 6-44
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.000000103
Family Lambda integrase-like, catalytic core 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390947639|ref|YP_006411399.1|
Sequence length 109
Comment site-specific recombinase XerD [Alistipes finegoldii DSM 17242]
Sequence
MQLRGEVTPHIGRHAFAVLAILKGMLLETLQKVFGHKSITYVLRIHSLVRRRRGNLFLEV
AHLYDQRADQLSQLLIRACFNNCQFHTKILFKILNMRQSNAHPISFPNR
Download sequence
Identical sequences A0A081UFX9 A0A139LNN6 A0A1Q6JRP3 A0A2J6A7M6 A7V5P1 B0MUF2 B0NMX7 B3JM65 B7AEV9 C9KS99 D0TRB1 D1JP12 D4IN04 D6CWF3 D7K897 E1WUQ4 E5V959 E5WXY5 I3YNZ6 Q64RV0
295405.BF3035 gi|479186731|ref|YP_007817077.1| gi|53714323|ref|YP_100315.1| gi|479163352|ref|YP_007792086.1| WP_004289226.1.10024 WP_004289226.1.10083 WP_004289226.1.10223 WP_004289226.1.10665 WP_004289226.1.15203 WP_004289226.1.15557 WP_004289226.1.16618 WP_004289226.1.17938 WP_004289226.1.18542 WP_004289226.1.19523 WP_004289226.1.19590 WP_004289226.1.2011 WP_004289226.1.20771 WP_004289226.1.20997 WP_004289226.1.24025 WP_004289226.1.26971 WP_004289226.1.28290 WP_004289226.1.29471 WP_004289226.1.30608 WP_004289226.1.30930 WP_004289226.1.31541 WP_004289226.1.32410 WP_004289226.1.34924 WP_004289226.1.39319 WP_004289226.1.4066 WP_004289226.1.43182 WP_004289226.1.43770 WP_004289226.1.43857 WP_004289226.1.44367 WP_004289226.1.45558 WP_004289226.1.456 WP_004289226.1.48748 WP_004289226.1.49999 WP_004289226.1.55270 WP_004289226.1.56960 WP_004289226.1.5868 WP_004289226.1.5909 WP_004289226.1.61830 WP_004289226.1.65409 WP_004289226.1.65726 WP_004289226.1.665 WP_004289226.1.67423 WP_004289226.1.72222 WP_004289226.1.72730 WP_004289226.1.75668 WP_004289226.1.77492 WP_004289226.1.77561 WP_004289226.1.79765 WP_004289226.1.80163 WP_004289226.1.82909 WP_004289226.1.84583 WP_004289226.1.84965 WP_004289226.1.87523 WP_004289226.1.88754 WP_004289226.1.90763 WP_004289226.1.91000 WP_004289226.1.91849 WP_004289226.1.94315 WP_004289226.1.94328 WP_004289226.1.94953 WP_004289226.1.97929 YP_100315.1.45732 gi|390947639|ref|YP_006411399.1| gi|375358085|ref|YP_005110857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]