SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947671|ref|YP_006411431.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947671|ref|YP_006411431.1|
Domain Number 1 Region: 34-109
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000424
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390947671|ref|YP_006411431.1|
Sequence length 421
Comment fibronectin type III domain-containing protein [Alistipes finegoldii DSM 17242]
Sequence
MKKLLPYLLLFILAGGGISCSDDDPTVPEPEAVMPPAPVASDITSDSFAISWEAVEGAVS
YTYTLQHKNPHGAITVIVPETNTDALSAAFTDLKASTAYTFRIKALGDGEKTLDSEWCEC
PVTTDEPEYLSGPWVTFEVNYEERTSYYCRITATFTPNDKTVAYYATCVYGSYFDDDPDD
PDFEPNTEEDMIGYLSAQKPISNNTLTESSWGYSTEYILAVVGVDADGNFGKLNWAKLKT
PARSSSGDQGQSEAALRIQHVVVNSSELEGAPENCFATVYRFEPTAGARAFRYEDGYYKG
DFAKKETSYWRQYFSSLANAYGEDYDGYYSGWKSSMDLEVSADGFYYYDVTFWDVSMANE
TFEVIYMAYDADGVPGVPACYTVTLPAEIPAVTPQQAPSAYKAAVAAANRLAHPQALPRR
R
Download sequence
Identical sequences I3YP28
WP_014776018.1.56960 gi|390947671|ref|YP_006411431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]