SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947675|ref|YP_006411435.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947675|ref|YP_006411435.1|
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily ADC-like 2.05e-48
Family Pyruvoyl dependent aspartate decarboxylase, ADC 0.0000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390947675|ref|YP_006411435.1|
Sequence length 119
Comment L-aspartate 1-decarboxylase [Alistipes finegoldii DSM 17242]
Sequence
MKFQIEVIKSKIHRVTVTQADLHYVGSITIDEALLEAANIIEGEKVQIMDIDNGERFETY
VIKGERGSGCICLNGAAARKVQVGDVIIIASYALMDFEDAKQFKPWIVFPDTATNRLVK
Download sequence
Identical sequences A0A1Q6FFK8 E4MDE5 I3YP32 R5V5W4
WP_009598363.1.56960 WP_009598363.1.9852 gi|390947675|ref|YP_006411435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]