SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947706|ref|YP_006411466.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947706|ref|YP_006411466.1|
Domain Number 1 Region: 2-204
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.98e-53
Family G proteins 0.00015
Further Details:      
 
Domain Number 2 Region: 151-300
Classification Level Classification E-value
Superfamily Translation proteins 2.21e-29
Family Elongation factors 0.01
Further Details:      
 
Domain Number 3 Region: 398-511
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.68e-25
Family EF-G/eEF-2 domains III and V 0.01
Further Details:      
 
Domain Number 4 Region: 302-387
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000000000468
Family EF-G/eEF-2 domains III and V 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390947706|ref|YP_006411466.1|
Sequence length 600
Comment GTP-binding protein TypA/BipA [Alistipes finegoldii DSM 17242]
Sequence
MQKLRNIAIIAHVDHGKTTLVDKMILAGNILRDNAKQSGELILDNNDLERERGITILSKN
VSVIYKDYKINIIDTPGHADFGGEVERVLNMCDGVLLLVDAFEGTMPQTRFVLQKALALG
KKPIVVVNKVDKPNCRPEVVNEQVFDLMFSLDATEEQLDYKTIYGSAKQGWMSHRWNEPT
DSIVPLLDAIIDEIPEPKIVEGTPQMLITSLEYSSYTGRIAVGKVTRGSLKAGQNVTLAK
RDGVTMQKTKIKDLMVFEGLGKKKADEVPCGEICALMGIEGFEIGDTICDYENPEPLPPI
AIDEPTMSMLFTINNSPFFGKDGKYVTSRHIKDRLDRELEKNLALRVTPGPSADSFNVFG
RGVLHLSVLIETMRREGYELQVGQPRVIVKEIDGKKCEPIEELTVDCPEEYSGTVIELAT
KRKGTLTNMASNGDRTRLEFSIPSRGIIGLRSNMLTATAGEAIMTHRLKGFEPWVGDIEM
RVNGSIISGETGTAYAYSIDKLQDRGRFFISPMEQVYEGQVIGEHTRQNDITVNVTKAKQ
LTNMRASGSDEKTSIAPPKIFSLEEALEYIQADEYVEVTPHSMRLRKILLHEVDRKRASK
Download sequence
Identical sequences A0A1Q6EYQ7 E4M9K5 I3YP63 R5ULX1
gi|390947706|ref|YP_006411466.1| WP_009596982.1.56960 WP_009596982.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]